SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015282 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015282
Domain Number 1 Region: 134-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 196-256
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000243
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000297
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 73-132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000264
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015282   Gene: ENSGALG00000009388   Transcript: ENSGALT00000015298
Sequence length 444
Comment pep:known_by_projection chromosome:Galgal4:3:17136650:17173601:1 gene:ENSGALG00000009388 transcript:ENSGALT00000015298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFDDLHACADPGAPEHGYKTPSAGVFFESVVVRFHCQEGYRLNGTSKKLCVRHFNGSLS
WKPSDKPVCLQEVTDCLVPHVEDAEIHNKTYRTGDKLIISCHEGFQIRYPDLDNMVSVCQ
DDGTWDNLPICQGCLRPLVLPHSYINISEFESSFSVGTVVYYQCFPGYKLEGAEFLECMY
NLIWSDSPPRCLDVEVCPLPPMVSHGDYICHPRPCERYNHGTVVEFYCDPGYTLTNDYKY
ITCQYGEWFPSYQVYCVKTEQTWPNTQETLLTTWKIVAFTATSVLLVLLLVILARMFQTK
FKTHFLPRGNQEGSMGDPDFVVVDGVPVMLPSYDEAVSSSLNALAPGYSATVDQGHILQT
EDQSPPAYPGPRITDMLPSEFESCESQSGSSELLQSLYSPPACQAAVRASSDRTDASRST
AGEAVSTSPRIDITDEIPLMEEDP
Download sequence
Identical sequences ENSGALP00000015282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]