SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015296 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015296
Domain Number 1 Region: 396-523
Classification Level Classification E-value
Superfamily CalX-like 3.27e-33
Family CalX-beta domain 0.00000525
Further Details:      
 
Domain Number 2 Region: 523-675
Classification Level Classification E-value
Superfamily CalX-like 4.19e-30
Family CalX-beta domain 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015296   Gene: ENSGALG00000009400   Transcript: ENSGALT00000015312
Sequence length 921
Comment pep:known chromosome:Galgal4:5:26903885:26982566:1 gene:ENSGALG00000009400 transcript:ENSGALT00000015312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLSLQPLTSAFLHFGLVTFVLFLHGLQVDAGLTGDSTSSVQNSSCSGSFDCKEGVILP
IWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGET
TTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFVAGDLGPSTIVGSAAFNMFII
IAICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFF
PLCVLLAWIADRRLLFYKYMHKKYRTDKHRGIIIESEGDHPKGIEMDGKMMNSHFLDGNL
VTVEGKEVDESRKEMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRM
MTGAGNILKKHAAEQAKKSTSLHEVRPDEPEEFISKIYFDPCSYQCLENCGAVLLTVVRK
GGDVSKTIYVDYKTEDGSANAGADYEFTEGTVVLKSGETQKDFAVGIIDDDIFEEDEHFF
VRLSNLRVVDNEEPPELGNSPYPKAILASPCVATVTILDDDHAGIFTFECDVIHVSESIG
VMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTVRVKIVDEE
EYERQENFFIALGEPKWMERGISALLLTQEVAERKLTVEEEEAKRIAEMGKPILGEHPKL
EVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFLEAITVSAAGDEDEDESGEERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCNGWACFVVSILIIGMLTAVIGDLASHFGCTIGLK
DSVTAVVFVAFGTSVPDTFASKAAAIQDVYADASITNVTGSNAVNVFLGIGLAWSVAAIY
WASQGQEFQVSAGTLAFSVTLFTIFAFICISVLLYRRRPHLGGELGGPRGCKLATTLLFV
SLWLLYILFATLEAYCYIKGF
Download sequence
Identical sequences ENSGALP00000015296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]