SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015577 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015577
Domain Number 1 Region: 108-319
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-59
Family Reprolysin-like 0.00054
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000981
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1057-1116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1210-1267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000916
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 813-874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000615
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 874-929
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000126
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 1007-1058
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 8 Region: 1272-1326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1155-1211
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 926-987
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 1323-1382
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000129
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 12 Region: 1509-1562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 13 Region: 701-754
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000772
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 14 Region: 1445-1491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000015577
Domain Number - Region: 1382-1436
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015577   Gene: ENSGALG00000009572   Transcript: ENSGALT00000015593
Sequence length 1764
Comment pep:known_by_projection chromosome:Galgal4:1:29866360:29950459:-1 gene:ENSGALG00000009572 transcript:ENSGALT00000015593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTFKAHDGEYFLEPLMKTDGGEHEDEHNKPHLIYRHEEINRKYQKSHKPCEVSEKEVKS
TLLHPNVSSLNEERNILLKSPSLEYASKNLSMEDAGNNPHSRKKRFLSYPRYVEVMVTAD
TKMVRHHGQNLQHYVLTLMSIVAAIYKDSSIGNLINIVIVKLIIIHNEQEGPTITFNAAT
TLRNFCIWQQAQNILDDAHPSHHDTAVLITREDICRAREKCDTLGLAELGTMCDPLRSCS
ISEENGLSAAFTIAHELGHVFNVPHDDSFKCKEAGIKHQYHVMAPTLNYHTSPWTWSKCS
QKYITEFLDTGYGECLLDKPSGRIYGLSSQLPGLMYDVNKQCELMFGLGSQVCPYLKQCK
RLWCTSTEGVHKGCRTQHMPLADGTVCGVGMHCRHGICVSRELEMRPVDGEWGPWGPYSS
CSRTCGGGIKSTTRLCNRPEPRNGGKYCVGRRMKFRSCNTDSCPKGEKDFREQQCSEFDG
KHFNINGLTSAVRWLPKYSGISMKDRCKLFCRVSGTTSYYQLKDRVADGTPCGAETNDLC
VQGLCRQAGCDHVLNSKARRDKCGICGGDNSSCKTLAGTFNRARYGYNVVVKIPKGATNI
DIRQHSYSGKPEDDNYLALSDIHGNFILNGNFVVSMSKREINIHGAIFEYNGSNNTVERI
NSTDRIEEELTLQVLCVGNLYNPDVRYSFNIPIEDRSDLFTWDPYGPWQDCSRMCQGIRR
RRMTCIRKSDHVVVSDQRCEHIPPVPDVSEECNTECELRWHSIGKSDCTSKCGPGYRSIE
IHCMKYSVSKGLSALVDDRYCADQQKPPTREACHGDCMLTSWHYAEWSECSRSCERGIRT
REAFCLNNLGRHLPDRECQELPRVVTESCNEFLCPSWSASEWSECPVTCGKGMKHRQVWC
QLNDEQLRDDFCNLNDRPGSVTPCELPECASWQVGPWGACTVTCGRGYQMRAVRCVTGTY
RVILDDDRECNAATRPRDNQECELPSCPETTKLWTTSLPLIHVGKVTQWRYGSWTPCSAS
CGKGDRARYVSCRDAHGGIADESFCAHLPRPAEVSSCFSPCGEWQVGNWSPCTVTCDSGI
ITRQVICVNYHQQINENYCDPEGRPSKEQECNMPPCPAVYHTPKIHEHPSHFPEAGYPPI
HHPLDNTNQWNHPSVGGYQWRTGPWGACSSTCAGGFHRRVVVCQDEEGRSASYCDEASKP
PESRHCDSGPCPRWNYGNWGECTQTCGDGIKTRLVICQLPTGQMLGDQNCEILDKPPNMA
QCNVHSCPGDVSWHRGPWKSCSVSCGKGLKHRDVHCFNSFRAKVEDGNCRHLKKPRTYKI
CRAGRCPTWKTSGWKECSVSCGVGIQQRDIYCQLKGLGKVSEAMCNHNARPAGHRPCWLP
ACMRYQWLADGWENCSTSYRRKEIHQKVKCVDEKQIQVDESFCDPATKPPSVKNCRRAPS
KYIVLTGELSQCSASCGLDYRQRITYCVGIHYVQNKHAYGLRTVAYRECPVTPSPYIYNC
NIKGCSQAATWRVGKWTKCSVSCGAGVKERTVACMTENGLSSDLCLPHLKPDNRRICHTE
ECEIITTCKDIQIKKGMRKDGEYLLNIKGRMIKIYCSDMHLDNPKEYLTLLKGEADNFSE
VYGLRLQNPYECPFNGSRRQDCACRNDYLAAGFTVFSKIRFDVASMQIRTTDFLFAQTIL
GRAVPFATAGDCYSAARCPQGQFSINLAGTGLRLSSTVRWMAQGNYATADIHKSHDGTKI
YGRCGGFCGKCVPNTITGLQLQIK
Download sequence
Identical sequences ENSGALP00000015577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]