SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015700 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015700
Domain Number 1 Region: 1247-1289,1321-1454
Classification Level Classification E-value
Superfamily Fibronectin type III 3.28e-33
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 1055-1244
Classification Level Classification E-value
Superfamily Fibronectin type III 7.34e-33
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 118-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-18
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 4 Region: 848-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 642-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 901-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 1003-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 796-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 748-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 10 Region: 695-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 576-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 12 Region: 952-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000015700
Domain Number - Region: 519-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number - Region: 341-416
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0102
Family APC10-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015700   Gene: ENSGALG00000009652   Transcript: ENSGALT00000015716
Sequence length 1516
Comment pep:novel chromosome:Galgal4:3:19699492:19792198:1 gene:ENSGALG00000009652 transcript:ENSGALT00000015716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCWALSLRCRFLFHAIETLILTYYDSFVLVSSQGHFPRLENVGAFKNVSTVPTQATCGL
PDRSTFCHSSVAAESIMSCTQRFCVQECPYRSSPPSYRLLFPEGLGTCVTEDKKDLPPGS
FSNASSFIFHNQKDCFSTPPLLRLSASFTLTVWLKPEQEGVMCVIEKAIDGQTVFKLTIS
EKETMFYYRTVNGLQPPIKIMTLGRILVKKWIHLSVQVHHSRISFFLNGWEDDSTPFDSR
ILVGTVADTNADGTLKIGQSFTGLEQFVGRMQDFRFYPVALTNRDILEVFSGRFPHLHTQ
SECRCPGSHPRVHPLIQRYCIPNGADDTTNDRVLRLDAEAHPLYYINDDDIGTTWISSVF
ANAAGLDHGVSITIDLQNGQYQVFYIILQFFSPHPEAIRIERKKRDDLNWEDWQYFAKNC
SIFGMDNNGSLEKPDSVNCLQLPSFTPYSYGNLTFSVLTPEPNHRPGYNDFYNTPSLQEF
VKATQVRIHMRGQYHTNESWVNFRHRYYGVNEVTVSGRCNCHGHADNCDTAMEPYRCLCI
KESYTEGIQCDRCLPLYNDKPFRPGDQVHAYNCKPCQCYSHAVSCHYDLEMDPFPQEYYR
GSGGVCDNCQHNTTGRNCELCKDFHYRQAGADLSAIDVCKPCDCYATGTKNKSLLCDNIG
GQCNCKRHVSGRQCNQCQEGFYNLQQSNPDGCSPCNCNTSGTVNGDITCHQNSGQCKCKA
NVIGPRCDSCNFGFKALRYSNEDGCEPCWCNSHGSVNQFCNPLTGQCNCKEQVKGLLCDT
CVDNFYGLDVTGCKACECNIAGSFAGTVCDARTGQCACKPNIGGRQCNECLDGYHRIQVN
HSFVCLPCDCDKAGTVNGSLLCDKSTGQCPCKAGVIGLQCNQCMLHTYNLSMRNLLGCQR
CDCDAKGTLAGTVCDHVSGQCVCLPHRQGRRCNECKPGFYFSPSSVTGCLPCLCHTAGSV
NQVCDKLTGQCICQDVSVTGRTCERCKEHHFGFDSVTGRCQHCNCHPAGAISGTCHLVTG
QCVCKQFVTGLKCDNCVPNASNLDVHNLFGCSKTPFQQPPPTGEVLNSSAISLSWNSPDS
PNSNRLIYLLYRDEAKIYTAEDYYPYSIHTFIDTALSPYTFYSYYVQASNIHGFTRSASV
TYRTKSGTPTGSLHLNPVFPVSHHSALLYWTAPSNDSGPIEKYILTCTVLVDLQPCGQYE
GLETSAIIWNLMPFTKYVFSVQACTSGGCLESQPVTVITAQAPPEGLKPPVIENISSTEL
SVEWSAPEKPNGIIIRYELYMRKKLKPFDDQPPPEIRVFQSSGWLSPQPVLESANENALA
PPQTSTTVSDLEPFTEYEFYVLAVNMAGSVSSDWMSGRTAEAAPVFMPSPSVFPLSPYSL
NVSWKKPEDNLSRGEVMGYSISLMTEQRFLPTFSQVLHIAEAHELSYIATGLKPYRTYNF
TITLCNQIGCVTSEPGMGQTLAAGKETIYISKASTHLSWQYNYLSTKCYASILKSQMPIK
QVISNVYFPLFQKRNA
Download sequence
Identical sequences ENSGALP00000015700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]