SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015864 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015864
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-33
Family C-type lectin domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015864   Gene: ENSGALG00000024425   Transcript: ENSGALT00000015880
Sequence length 123
Comment pep:novel scaffold:Galgal4:AADN03010709.1:196:1147:-1 gene:ENSGALG00000024425 transcript:ENSGALT00000015880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVGFQGKCYYFSKEENDWNSSREHCNAHGASLVTIGSAEEMDFMMRFQGPANCWIGLHRE
EEDAQWTWSDGTAFTNWFELRGGGRCAYLNGDRISSSLCHLHKHWVCSRADHYVLWKQKV
HPQ
Download sequence
Identical sequences ENSGALP00000015864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]