SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015874 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015874
Domain Number 1 Region: 109-260
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-35
Family C-type lectin domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015874   Gene: ENSGALG00000009771   Transcript: ENSGALT00000015891
Sequence length 265
Comment pep:known chromosome:Galgal4:1:1735:16308:1 gene:ENSGALG00000009771 transcript:ENSGALT00000015891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPFPAPRGDGARRRRRTAVSESFPPRSLREVLAKKSAPPAPLCPQPGPSLPLSPHTMG
AVPHLHGAKGERERRSPSPPREATAREGDEERQSQRGSGCSKLRQNRRCVLCVALCAVLC
ILVSVVVAVIVLQRPSCPPRPPFSHVYPNTWVGFHGKCYYFSDTKSDWKSSREQCHRLGA
SLATVDREEEMEFMRGYRRPADRWIGLHRAEGDEHWTWADGSAFSNWFKPQGGGQCVYLH
GDWINSTLCHSEKFWVCSRADSYVL
Download sequence
Identical sequences ENSGALP00000015874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]