SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016152 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016152
Domain Number 1 Region: 2085-2159,2186-2235,2301-2326,2364-2562
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-86
Family Hect, E3 ligase catalytic domain 0.000049
Further Details:      
 
Domain Number 2 Region: 363-485
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-25
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 1268-1336
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.35e-22
Family Mib/herc2 domain 0.00000897
Further Details:      
 
Domain Number 4 Region: 10-215,512-638,891-969
Classification Level Classification E-value
Superfamily ARM repeat 9.72e-22
Family Armadillo repeat 0.022
Further Details:      
 
Domain Number 5 Region: 1088-1240
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000193
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016152   Gene: ENSGALG00000009946   Transcript: ENSGALT00000016171
Sequence length 2570
Comment pep:known_by_projection chromosome:Galgal4:5:33616118:33666611:-1 gene:ENSGALG00000009946 transcript:ENSGALT00000016171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ
DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM
AAAGGTASGPSSACKPGRTSTGAPSTAADSKLSNQVSTIVSLLSTLCRGSPVVTHDLLRS
ELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDEKKKKDANKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQQTMLPSI
RKASLALIRKMIHFCSEALLKEVCDSDAGHNLPTILVEITATVLDQEDDDDGHLLALQII
RDLVDKGGDLFLDQLARLGVISKVSTLAGPSSDDENEEESKPEKEDEPQEDAKELQQGKP
YHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSES
RSEFLEKLQRARSQVKPSTASQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNSDGQQATI
LKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVRTMARDL
YDDHFKAVESMPRGVVVTLRNIATQLESAWELHTNRQCIEGENTWRDLMKTALENLIVLL
KDENTISPYEMCSSGLVQSLLTVLNNNVDLDMKQDCSQLVERINVFKTAFSENEDDESRP
AVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERASGETSLIDRTGRML
KMEPLATVESLEQYLLKMVAKQWYDFDRASFVFVRKLREGQTFVFRHQHDFDENGIIYWI
GTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDSSALNCHTNDDKNAWFAID
LGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL
DPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLR
RQRRLVRSQVLKYMVPGARVIRGIDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSN
SYRMGAEGKFDLKLAPGYDPDSAASPKPVSSTVSGTTQSWSSLVKNNCPDKTTAAAGSSS
RKGSSSSVCSVASSSDISLGSTKMERRSESVMEQNIVSGTDVHEPIVVLSSADNVPQAEV
GSSSSASTSTLTADMGNENTERKLGPDNSIRTPGESSAISMGIVSVSSPDVSSVSELTNK
EAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNA
TNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTTGTTSTVTMSTSSVTSSSN
VATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDED
LPEPDEEDDENEDDNQEDQEYEEVMEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPR
PGRTNVQQTTDLEIPPPGTPHSELLEEVECMPSPRLALTLKVSGLGTTREVELPLTNFRF
TIFYYVQKLLQLSCNGSVKSDKLRRIWEPTYTIMYREMKDSDKEKESGKMGCWSVEHVEQ
YLGTDELPKNDLITYLQKNADSAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGSKS
GLSQGAISTLQNSDILSLAKEQPQAKAGSGQNSCGVEDVLQLLRILYIVASDPYTARTSQ
EEGDEHPQFNFPPDEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETR
QLYFTCTAFGASRAIVWLQNRREATVERTRTTSTVRRDDPGEFRVGRLKHERVKVPRGES
LMEWAENVMQIHADRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDDFP
DDESRQVDIGGGLKPPGYYVQRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNR
LVDLPISKPFFKLMCMGDIKSNMSKLIYESRSDRDLHCTESQSEASTEEGHDSLSVGSLE
EDSKSEFILDPPKPKPPAWFNGILTWEDFELINPHRARFLKEIKDLAIKRRQILSNKSLS
EDEKNTKLQELMLKNPSGSGPPLSIEDLGLNFQFCPSSKVYGFTAVDLKPGGEDETVTMD
NAEEYVDLMFDFCMHTGIQKQMEAFRDGFNRVFPMEKLSSFSHEEVQMILCGNQSPSWAA
EDIINYTEPKLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRL
TVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN
Download sequence
Identical sequences A0A1D5PMI4
XP_421227.3.86415 ENSGALP00000016152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]