SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016283 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016283
Domain Number 1 Region: 733-979
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-62
Family Nuclear receptor ligand-binding domain 0.0000000603
Further Details:      
 
Domain Number 2 Region: 601-679
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-27
Family Nuclear receptor 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016283   Gene: ENSGALG00000010035   Transcript: ENSGALT00000016302
Sequence length 981
Comment pep:known chromosome:Galgal4:4:31566745:31763750:-1 gene:ENSGALG00000010035 transcript:ENSGALT00000016302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHSYPEGLDMERRWGQVPQSVEYSSLGPGEQADASNYMEIVNVSCAAGTFANSSA
PGNKEKPELLSCLQQDSSHPAVLPSDIKTETESKELSATVAESMGLYMDSIRDADYPYDQ
QNQGSPGKIYQNVEQLVKLYKENGHCSSPLHSPSRPLRSLMADSGSAMNGGAMHTVVKSP
IVCQEKSPSGCSPQNMASSVCSPAGVNSVSSTTANFGNFAMHSPIGQGTPLSRSPNVESR
GSMLHSPAHVSNVGSPLSSPISSMKSPISSPPSHCSVKSPVSSPNNITMRSSVSSPANMN
SRSSIASPSNANNRSTRSSPAVSTVGGSSICSPVNSSLGFPASSTPAGPSRSQDTVPSPE
TKDKGAQEIPFPKMEEMENAISNNSQMNLVQFIKPEPDGSFGSACIGENSKISSDCPFSV
PVKQESAKHPCSGASFKGNQTVNPFPFTDGSYFSFMDDKDYYSLSGILGPPVSSFDSSCE
GSGFPNPGLPVGIKQEPDDGSYYQDSSIPSSAIVGVNSGGQSFHYRIGAQGTISLSRPVA
REQAFQHLSSFPPVSTLVETWKSHSELASRRSDGYPVLEYIPENVSSSSLRSVSSGSSRP
SKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
LQKCLQAGMNLGARKSKKLGKLKGMHEEQPQQRQQPPPQSPEEGTTYIAPVTEPPVNTAL
VPHMSAISPALTPSPVKILESIEPEIVYAGYDSSKPDTAEYLLSTLNRLAGKQMIQVVKW
AKILPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLIFDEERMRQS
AMFELCQGMHQISLQFVRLQLSFEEYTIMKVLLLLSTVPKDGLKSQAAFEEMRANYIKEL
KKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVEI
ISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G1K325
ENSGALP00000016283 XP_015131585.1.86415 XP_015131587.1.86415 XP_015131588.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]