SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016591 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016591
Domain Number 1 Region: 505-839
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-73
Family Hect, E3 ligase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 161-359
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-40
Family APC10-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016591   Gene: ENSGALG00000010217   Transcript: ENSGALT00000016610
Sequence length 851
Comment pep:known chromosome:Galgal4:8:19826291:19837302:-1 gene:ENSGALG00000010217 transcript:ENSGALT00000016610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVRSAMRAGGEAPHQVLGRLRFLLQCSECFRRARPLPAALCYVPREVQYKICKDPSAAAS
SRSLLSVWDSPGPARGSKRAARATIEVRKGGCLRATGEEYCNSAGLWVKLSKEQLEEYKS
GCDLEEGWVLVCKHAEGGDRLVPVESTERIQRQQQLFGVDYKPVIRWEQVVDLTYSLRLG
AKPKPMDQDEAAVEKLRFVPPTWTYECDEDLVHFLYDHIGKEDENLGSVKQYVDSIDVSS
YTEDFNVSCLTDSHADTYWESDGSQGQHWVRLNMKKGTIVKKLLLTVDTTDENFMPKRVA
VYGGEGDNLKKLNDVGIDESYIGDVCVLEDMTTHLPVIEIRIVECRDDGIDVRLRGIKIK
SSRQRDLGLSADMFQLANLVRYPRLEGTDPDLLYRRAVLIQRFIKLLDSVLHHLVPAWDH
TVGTFSKLKHIKQFLLLSKRRTALITQCLKDSETSKPNFMPRLYINRRLAMEHRDNPALD
PSCKNAVFTQVFEGLKPSDKFEKPLDYRWPLRYDQWWECKFIAEGIIDQGGGFRDSLADM
SEELCPSSADTPVPLPFFVRTSNQGNSTGEARDMYVPNPSCKDFPKYEWIGQIMGAALRG
KEFLVLALPGFVWKQLTGEEVSWSKDFAAVDSVLVKLLEVMEVMDRDTFEFKFGNELTYT
TVLSDQRMVELIPNGSNTVVHYEDRKEFIRLVQKARLEESKEQIMAMQAGLLKVVPQAVL
DLLTWQELEKKVCGDPEVTVDALKKLTRFEDFEPLDTRVQYFWEALNNFTNAEDRSRFLR
FVTGRSRLPARIYIYPDKLGSETTDALPESSTCSSTLFLPNYATAKVCEEKLRYAAYNCV
AIDTDMSPWEE
Download sequence
Identical sequences ENSGALP00000016591 ENSGALP00000016591 9031.ENSGALP00000016591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]