SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016612 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016612
Domain Number 1 Region: 33-282
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.94e-88
Family Eukaryotic proteases 0.000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016612   Gene: ENSGALG00000026354   Transcript: ENSGALT00000016631
Sequence length 284
Comment pep:known chromosome:Galgal4:1:77626337:77629983:1 gene:ENSGALG00000026354 transcript:ENSGALT00000016631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKCYEKPPIFRNAKDVFLEAQVASPPVWDQGCVKIMKFLVLVAFVGVAVAFPISDEDDD
KIVGGYSCARSAAPYQVSLNSGYHFCGGSLISSQWVLSAAHCYKSSIQVKLGEYNLAAQD
GSEQTISSSKVIRHSGYNSNTLNNDIMLIKLSKAATLNSYVNTVPLPTSCVTTGTTCLIS
GWGNTLSSGSLYPDVLQCLNAPVLSSSQCSSAYPGRITSNMICIGYLNGGKDSCQGDSGG
PVVCNGRLQGIVSWGFGCAQKGYPGVYTKVCNYVSWIKTTMSSN
Download sequence
Identical sequences ENSGALP00000016612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]