SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016613 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016613
Domain Number 1 Region: 23-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.6e-85
Family Eukaryotic proteases 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016613   Gene: ENSGALG00000027291   Transcript: ENSGALT00000016632
Sequence length 248
Comment pep:known chromosome:Galgal4:1:77645788:77649134:1 gene:ENSGALG00000027291 transcript:ENSGALT00000016632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLVLVTFVGVAVAFPISDEDDDKIAGGYSCARSAAPYQVSLNSGCHFCGGSLISSQWV
LSAAHCYKSSIQVKLGEYNLAAQDGSEQTISSSKVIRHSGYNSNTLNNDIMLIKLSKAAT
LNSYVNTVPLPTSCVTAGTTCLISGWGNTLSSGSLYPDVLQCLNAPVLSSSQCSSAYPGR
ITSNMICIGYLNGGKDSCQGDSSGPVVCNGQLQGIVSWGFGCAQKGYPGVYTKVCNYVSW
IKTTMSSN
Download sequence
Identical sequences ENSGALP00000016613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]