SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016869 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016869
Domain Number 1 Region: 155-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-74
Family Nuclear receptor ligand-binding domain 0.00000000729
Further Details:      
 
Domain Number 2 Region: 105-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.08e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016869   Gene: ENSGALG00000010365   Transcript: ENSGALT00000016888
Sequence length 438
Comment pep:known_by_projection chromosome:Galgal4:5:37917633:38040716:1 gene:ENSGALG00000010365 transcript:ENSGALT00000016888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGRMATEERHLSSSCGSFIKTEPSSPSSGIDAISHHSPSGSSDASGGYGIAMGGHPNG
LDSPPMFNGTGIGGGSCRKRYDDCASAIMEDSPTKCEYMLNAIPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL
DRVRGGRQKYKRRLDSESSTYLSLQIPPPAKKPLTKIVSHLLVAEPEKIYAMPDPTMPES
DIKALTTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSLPY
EDKLVYAEDYIMDEEHSRLTGLLELYLAILQLVRRYKKLKVEKEEFVTLKALALANSDSM
HIEDMDAVQKLQDLLHEALQDYELSQRNEEPRRAGKLLLTLPLLRQTAAKAVQHFYSIKL
QGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences A0A1D5PDM1
ENSGALP00000016869 XP_005013926.1.99704 XP_005520299.2.90289 XP_008637839.2.15636 XP_008923209.2.51550 XP_010391469.1.2935 XP_011571172.1.59079 XP_013041031.1.65836 XP_014797426.1.91963 XP_015143197.1.86415 XP_015143198.1.86415 XP_015143199.1.86415 XP_015487420.1.82291 XP_017691198.1.3805 XP_018762930.1.15306 XP_019471305.1.16129 XP_021258593.1.32913 XP_021398480.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]