SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017021 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017021
Domain Number 1 Region: 253-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000129
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017021   Gene: ENSGALG00000010468   Transcript: ENSGALT00000017040
Sequence length 491
Comment pep:known_by_projection chromosome:Galgal4:5:38524087:38527515:-1 gene:ENSGALG00000010468 transcript:ENSGALT00000017040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQGDCSAQKSRSCFSRQQPPSGDGWVSEGPSLLPLPLQVSASSDPRAAGDEELPPSGRA
RGLRRSGQAGPRRHRRRGATQQTMRSPVQPQPSGAGQEESLPFVLDLQSLPGLANVDLSA
QNPNIQVTIEVVDDPQAEMEMDLLKETSNDWSLTSSEWLSHKDLFWPLFWEYTDPNEGEE
EEEEDDNMDVGDREEEEDEEDEDEEEEEDYTAEYEEEESMLSGVGDDWEQRWPSQKNWIF
KEKYNYDYEDEEEWSPWSPCSITCGSGNQKRTRSCGYACTATESRTCDLPRCPGAEGEIV
FPTEETPFRSDNTTELFNSDVDSCEKWLNCKSDFLTKYLSKVLTDLPSCPCSYPLEAVYS
AVNLRDERQGKSFRWRDASGPKERLDIYKPTARFCLRSMLSLDSTTLAAQHCCYDEHTRL
ITRGKGAGVPNLISTEFSPELHYKVDMLPWILCKGDWSRYHAVRPPNNGQQCADNPAEEE
YLSQLQEAKEY
Download sequence
Identical sequences F1NNP1
ENSGALP00000017021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]