SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017370 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017370
Domain Number 1 Region: 413-675
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-56
Family YWTD domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 329-406,676-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 160-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 4 Region: 125-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 208-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 6 Region: 244-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 7 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 40-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 9 Region: 79-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 10 Region: 290-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017370   Gene: ENSGALG00000010692   Transcript: ENSGALT00000017391
Sequence length 894
Comment pep:known chromosome:Galgal4:8:23561280:23710577:-1 gene:ENSGALG00000010692 transcript:ENSGALT00000017391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVKECDKDQFQCRNERCIPAVWACDEDNDCSDNSDEADCPKKTCAETDFACDNGHCIPD
RWKCDGEEECSDGSDESEAACTKQVCPAEKISCGDLSNKCIPSSWRCDGQKDCESGIDEA
GCAPACSPDEFQCSNKTCISINFVCDGYNNCGDGSDEKKCSPLTCSPNEFQCNNSVCIPQ
LWVCDNQADCEDHSDESIERCGYDAKAFNTCAAHEFQCGNGECILLNWKCDGDEDCKDKS
DEQDCPLVTCRPDEFQCGDGTCIHGAKQCDKVHDCPDNSDEAGCVQESACESPSKFQCKS
GECIDGGKVCDLHRDCRDWSDEPLKECGINECSLNNGGCSHICKDLKIGYECECPPGYKL
LDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDTLSKNCKAVGKSPYLIFTNR
HEVRKIDLVKRDYSRIIPMLKNVVALDVEVATNRIYWCDLFYRKIYSAYIDKASDTAEQV
ILIDSQLNSPEGLAIDWVHKNIYWTDSGNKTISVATADGSRRRTLFNSDLSEPRAIAVDP
TRRFMYWSDWGDKAKIEKAGLNGVGRQVLVSDNIEWPNGITLDLLNQRLYWVDSKLHSLS
CIDFNGSNRKVLISSVDDLSHPFGLAVFEDRVFWTDLENEAIFSANRLSGLDISVLAENL
NNPHDIVVFHELKQPKAPDSCELSPQPNGGCEYLCLPAPHISPHSPKYTCACPDNMWLGP
DMKKCYKELPTTPATVEVPTTTTSHPAATSTVTVTGSANTTTAVIPRAVSEATTAIPSSH
STTSLLIDSEMTTGNSNLSQHYSNNGQGFDSTVTAAVIGIVIPVVVIGLLCMGGYLIWRN
WKRKNTKSMNFDNPVYRKTTEEEDEDEIHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences ENSGALP00000017370 ENSGALP00000032394 9031.ENSGALP00000017370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]