SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017421 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017421
Domain Number 1 Region: 180-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000536
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 1268-1325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000693
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 617-680
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 1017-1076
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1395-1459
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000615
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 680-752
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 7 Region: 350-404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 757-810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 9 Region: 1147-1201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 1323-1373
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0082
Further Details:      
 
Domain Number 11 Region: 1075-1146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 888-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 13 Region: 411-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000929
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017421
Domain Number - Region: 1202-1258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000327
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 498-560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00222
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number - Region: 945-1016
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0462
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017421   Gene: ENSGALG00000010718   Transcript: ENSGALT00000017442
Sequence length 1642
Comment pep:known_by_projection chromosome:Galgal4:2:26394647:26589579:-1 gene:ENSGALG00000010718 transcript:ENSGALT00000017442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSEGSTAFPRGPGLSTSPARCVGVLVVLLLGNWGARAQSEFQTSSVYLWKTGPWGRCM
GDECGPGGIQTRAVWCAHVEGWTTLPTNCKQPERPDNQQSCFRVCDWHKELYDWQIGTWD
HCRPVLSRSHEKPQECLRGEDGIQTRDITCIQKSNGVPAEDVICEYFEPKPRQEQACLIP
CRQDCIVAEFAPWTECSKTCGSGLQHRTRHVVAPPQFGGSACPNLTEFQVCQSSPCAAEE
SLYSLNVGPWSVCSVPHSRQIRQARKRGKSKDKEKDREKAVRDPEARELIKKKRNRNRQN
RQDNKYWDIQIGYQTRQVTCTHRNGKTAALSFCKQDKLPITFQSCVITKECQVSEWSEWT
PCSKTCFDMTTPKGNRTRSRTIKQLPIGSESECPQLEETEQCITQGDGVAPCITYGWRTT
EWTECRVDPLLSQQDKRRGNQTALCGGGIQTREMYCVQANENLLSYLNTLKEKEASRPVD
RRLCTGPLPSTSQLCHIPCPTECETSAWSAWGPCTYENCDDPQAKKGFKLRKRRITNEPT
GGTGNCPHLLEAIPCEEPSCYDWRIVGLEECVPDNEKPCGPGTQVPIVICVNSDGEEVDR
QLCRDAIYPIPVVCEAPCPKDCVLSMWSAWSSCSHTCSGKTTEGKQMRARSILAYAGEGG
VQCPNSSALQETRSCNEHSCTVYHWQTGPWGQCIEDASVSAFNSSASWNGEATCSVGMQT
RKVICVRVNVGQVGPKKCPENLRPETVRPCLLPCRKDCIVTPFSDWTLCPSSCQEGDVIV
KKQSRHRVIIQLPANGGRECPDTLFEEKECEASPICYNYRWKTHKWRRCQLVPWYVRQDS
PGAHETCGPGLQARAITCRRQDGGQADISECLKYAGPLPSLTQTCQIPCQDDCQFTNWSK
FSSCNGDCGGVRTRKRTLIGKSKKKDKCKNSQLYPLIENQFCPCDKYSAQPVGNWSDCIL
PEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNSRLVETSRCNSHGYIEEACIIPCPS
DCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQVYEVVPCHSDC
SQYIWVTEPWSVCKVTNVDLKENCGEGVQTRKVRCMLNTVDGPSDTVEDYLCDPEEMPLG
ARKCTLPCPEDCVMSEWGSWSRCSLPCNGSSVRERSSEFLRQPVEGKSCPAATEREVCTL
NKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVDLKYCEELGLEKTWQM
NISCVVECPVNCQLSDWSSWSDCSQTCGLTGKMIRRRTINQPFQGDGRPCPSQMEQFKPC
PVKPCYQWQYGQWSACKVEDAQCGEGTRVRNISCVVFDGSIEDVGKIVDEEFCGEIEPII
DGNKKMILEETCTVPCPGDCYLKEWSEWSLCQLTCVNGEDLGFGGIQVRSRAVIIQDLEN
QHLCPEQALETRPCNDGHCYEYKWMASPWKGSSRTVWCQRSDGLNVTGGCLVMRQPDADR
SCNPPCSQPHAYCSETRTCSCEDGYTEVMSSDGTLEQCTLIPVVVIPTMEDKKGDVKTSR
AVNPTQPSTNLSGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIVSMIYLACKKPKK
PQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences ENSGALP00000017421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]