SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017428 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017428
Domain Number 1 Region: 111-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017428
Domain Number - Region: 46-151
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number - Region: 178-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000369
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 147-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00549
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017428   Gene: ENSGALG00000010722   Transcript: ENSGALT00000017449
Sequence length 211
Comment pep:known chromosome:Galgal4:2:26752974:26765336:1 gene:ENSGALG00000010722 transcript:ENSGALT00000017449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRAGGSGGPRLLLWLWLVLCGMPGGSAQYSRGAGRPRSWGPATACSPRCLHGGLCLGN
GTCLCSKGYEGELCQHATCYPKCKNGGECLRPGKCRCPPGYGGRYCHKVSCEGGCQNGGE
CISVNGVVKCLCASGWTGSRCQEAICPQGCRNNGACVAPGICSCPAGWVGGACHLAVCKL
PCQHGGKCIAPNVCRCRLPYSGLQCTKKRKE
Download sequence
Identical sequences Q6TPK5
ENSGALP00000017428 ENSGALP00000017428 NP_989829.1.86415 9031.ENSGALP00000017428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]