SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017464 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017464
Domain Number 1 Region: 136-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 241-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000379
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 15-70,108-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000116
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017464
Domain Number - Region: 283-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017464   Gene: ENSGALG00000010747   Transcript: ENSGALT00000017485
Sequence length 444
Comment pep:known chromosome:Galgal4:5:43740994:43781814:-1 gene:ENSGALG00000010747 transcript:ENSGALT00000017485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLKRILTAFTLTICLSSPGKAQQQCTNGFDLDRASGQCLDIDECRTIPEACRGDMVCV
NQNGGYLCVPRTNPVYRSPYLNPYSNIYPPPPAPGPVPNYPTVTRPLICRFGYQLDENNQ
CADIDECASDSHQCNPTQICINTEGGYTCSCTEGYWLLEGQCLDIDECRYGYCQQLCANV
PGSYSCTCNPGFTLNDDGRSCQDVNECTGENPCSQTCVNTYGSFLCRCEPGYELEADGVN
CSDMDECSFSEFLCQHECVNGPGSYYCVCPSGYNLLDDSRSCQDINECEIRNFTCTLQQT
CFNIPGEYKCLDPVRCEEPYIQINENRCMCPAENPGCRDQPFTILYRVMDVLSGRSVPSD
IFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPVKGPRTVQLDLEMIT
VNTVINFRGSSVIRLRIFVSQYSF
Download sequence
Identical sequences E1C1G8
9031.ENSGALP00000017464 NP_001264403.1.86415 ENSGALP00000017464 ENSGALP00000017464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]