SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017534 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017534
Domain Number 1 Region: 169-243
Classification Level Classification E-value
Superfamily Homeodomain-like 3.46e-26
Family Homeodomain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017534
Domain Number - Region: 62-107
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0418
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017534   Gene: ENSGALG00000010794   Transcript: ENSGALT00000017555
Sequence length 302
Comment pep:known chromosome:Galgal4:2:28171684:28225369:-1 gene:ENSGALG00000010794 transcript:ENSGALT00000017555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHTLFGCLRSPHATAQSLHPFSQSSLALHGRSDHMSYPDLSSSSSSCIITGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHIPQMSSPPAAARHSLCLQPDSGGPPELG
SSPPVLCSNSSSLGTTTPTGAACAPGDYGRQALSPVETEKRSGKRKSDSSDSQEGNYKSE
VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKW
KRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAAGLQHTGDSLANDDSHDSDHSSEHA
HL
Download sequence
Identical sequences F1NM26 G1NCH1
ENSMGAP00000010445 ENSMGAP00000010445 ENSGALP00000037149 XP_003207159.1.16129 XP_015709350.1.68032 XP_021244065.1.32913 ENSGALP00000017534 9031.ENSGALP00000017534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]