SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017612 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017612
Domain Number 1 Region: 557-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 104-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000294
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 52-99
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017612
Domain Number - Region: 512-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017612   Gene: ENSGALG00000010850   Transcript: ENSGALT00000017633
Sequence length 603
Comment pep:known_by_projection chromosome:Galgal4:8:24711328:24727316:1 gene:ENSGALG00000010850 transcript:ENSGALT00000017633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWSLCQVSPLILTICSLSITARWATAAACGEPAAVPAQRRSSRDISSPPPVDCQLSQWS
EWTDCFPCQGRKHRHRTLLQPAMFGGQRCKGPLWDEQSCSAWESCARAPSCGNDFQCKES
GRCIKQHLVCNGNTDCRDGSDENDCEHEEIEHPCDNLFPIPGSEKAARGYNILTQEAKRY
IYDPKFLGSHCESVYNGEWRALRYDAACERLYYGDDEKYLLKPYNFHVYQFLAHADSGFS
SEFYDDSKDLIDALKSSKSEGGGFTIGIGPKKIDFKLNLGFTLSRGKGSLKNFTEYTAKN
LGFIRIATKVQTARFKMRRNNIVLDEDMLISLRELPDTYNYGMYAKFINDYGTHFMTSGT
MGGDLEYILVVNKEEMRRKDISYEEVTTCFGLSLGVSAKKLMLHWEASVSLSVCAEKQLL
NAVDFSDAGSNSPVMEDIIVRIKGGDTSYSARPISSWDSNTYRRWGRSLKYNPAIIDFEL
QPIHEILPRSDAGNMETKRQHLKQALDEYLLEFNACRCGPCQNNGEPVLVGDECSCQCPS
GYSGPACERSEHQGTEVDGRWSCWSSWTPCQSGSRRRSRQCTNPAPQHGGAPCMGRDVQS
SSC
Download sequence
Identical sequences F1NJU5
ENSGALP00000017612 XP_015146668.1.86415 XP_426667.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]