SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017617 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017617
Domain Number 1 Region: 538-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 2 Region: 117-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 58-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017617
Domain Number - Region: 166-215
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0298
Family Tail specific protease, catalytic domain 0.015
Further Details:      
 
Domain Number - Region: 214-241
Classification Level Classification E-value
Superfamily MxiH-like 0.0445
Family MxiH-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017617   Gene: ENSGALG00000010853   Transcript: ENSGALT00000017638
Sequence length 584
Comment pep:known_by_projection chromosome:Galgal4:8:24731782:24747335:-1 gene:ENSGALG00000010853 transcript:ENSGALT00000017638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVAWMAFTLCPIKLLLLCAALCFLDVHCFSSGTESLGPISTSSRQARSVRNPPQPRDCV
LSTWSSWSKCDPCQKKRYRFARLEQPSQFNGEPCDYSDNESEDCVTNNPCRNKVRCEGFA
CAVTGRCIARRLLCNGDDDCGDQSDEKNCKKVFKKCDQKMEQYWGIENLAKGLNIITKNL
EGLVLDHRYYAGGCSPHYIADTRFRKPYNVESYTPETKGKYEFTMTEYDSYSNYESSVLK
AEAAQSSFSIGISIPSLFEIGYSNNDNRFRKFIQRMKRFSSTSSKFLHARSDLTVAVYKL
KTRALMLHYEFLQRLHQLPLEYSYGEYRELYRDYGTHYITEATVGGIYEYTLVLNSNELQ
KAGFSMSDVQKCAQHGFKIGGTIKAVSLILGVNVEGCKSLLKEIGDSTSKKQYVEDFIAL
VRGGASEHITALANKGLPTAALMQEWGDAVQYNPEIIKLKVQPLYQLVTPADFANAMTIK
ENLRRALDEFQLETSSCRCAPCQGNGIPVLKGTHCECICPLSRRGTACETPSRTDAAING
NWGCWASWSPCSGGQRTRRRQCNNPTPQNGGSSCSGPDAETVTC
Download sequence
Identical sequences E1C7C1
XP_422502.2.86415 ENSGALP00000017617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]