SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000017932 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000017932
Domain Number 1 Region: 427-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-76
Family Protein kinases, catalytic subunit 0.000000254
Further Details:      
 
Domain Number 2 Region: 270-353
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-33
Family Kringle modules 0.00063
Further Details:      
 
Domain Number 3 Region: 22-114
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-22
Family I set domains 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000017932
Domain Number - Region: 130-217
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00262
Family Frizzled cysteine-rich domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000017932   Gene: ENSGALG00000011019   Transcript: ENSGALT00000017953
Sequence length 896
Comment pep:known chromosome:Galgal4:8:26884366:26926589:1 gene:ENSGALG00000011019 transcript:ENSGALT00000017953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTSSWNISSELDRDYFLTLDEPMNNITTTLGQTAELHCKVSGNPPPTVRWLKNDAPVVQ
EPRRISFRATSYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGS
SDEYEEDGFCQPYRGIACARFIGNRTIYMESLHMQGEIENQITAAFTMIGTSSHLSDKCS
QFAIPSLCHYAFPYCDETSPAPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
NCEDLPQPDSPEAVNCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTRSGRQCQPWNSQ
YPHTHTFTAIRYPELNGGHSYCRNPGNQKDAPWCFTLDENFKSEICDVPACDYKDAKEKN
KMEILYILVPSVTIPLAIALLFFFICICRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYK
PKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLIAIKTLKDFNNPQQWAEF
QQEASLMAELHHPNIVCLLGVVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDED
GTVKSSLDHGDFLHIAVQIAAGMEYLSSHFFVHKDLATRNILIGEQLHVKISDLGLSREI
YSADYYRVQNKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQE
VIEMIRKRQLLPCSEDCPPRMYSLMTECWHDLPSRRPRFKEIHTRLRSWEGLSSHTSSTT
PSGGNATTQTTSLSASPVSNLSNPRYPNYMFPAQGIPQGQIAGFIGPPIPQNQRYIPING
YPIPAGYAAFPAAHYQPQGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEAN
IPLLSHMSIPSHPGGIGITVFGNKTQKPYKIDSKQSSLLGDSSIHGPNESVISAEL
Download sequence
Identical sequences F1NML5
ENSGALP00000017932 NP_989840.2.86415 9031.ENSGALP00000017932 NYSGRC-IgSF-NP_989840 ENSGALP00000017932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]