SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018165 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018165
Domain Number 1 Region: 349-487
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-32
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 2 Region: 214-343
Classification Level Classification E-value
Superfamily C-type lectin-like 5.33e-31
Family C-type lectin domain 0.00089
Further Details:      
 
Domain Number 3 Region: 945-1093
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-27
Family C-type lectin domain 0.0041
Further Details:      
 
Domain Number 4 Region: 1396-1514
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-26
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 5 Region: 1540-1670
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-26
Family C-type lectin domain 0.00094
Further Details:      
 
Domain Number 6 Region: 633-793
Classification Level Classification E-value
Superfamily C-type lectin-like 8.8e-26
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1106-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-24
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 8 Region: 499-627
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-21
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 30-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.67e-21
Family Cysteine rich domain 0.034
Further Details:      
 
Domain Number 10 Region: 1238-1366
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-20
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 11 Region: 152-209
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-18
Family Fibronectin type II module 0.0014
Further Details:      
 
Domain Number 12 Region: 821-931
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000844
Family C-type lectin domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018165   Gene: ENSGALG00000011153   Transcript: ENSGALT00000018187
Sequence length 1732
Comment pep:known chromosome:Galgal4:7:21382006:21420596:1 gene:ENSGALG00000011153 transcript:ENSGALT00000018187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPAGRCAAACCIAWLLACCAARRDDTGSGAFTIRHDTLNKCIQVKNSRIVVDDCKETS
EALWKWVSQSRLFHLGTKQCLGLDIFTKLPSRLRMVDCNSDLRLWWRCADGSVVGASQYK
VTVRSAYVTASINASDQWRSNNSSADICQYPYHEVYTKDGNSYGKPCEFPFLYNMTWHHD
CIQDGTHTGRKWCATSEDYTRDGKWGICLQPEDGCHDIWEHDASSQHCYQFNTQSALSWK
EAYVSCQRQGGDLLSIQDASELNYIQAKDDIAEIFWIGLNQLDVSRGWQWSDHKPLNFVN
WHPDMWDLSPLDGTSCVAMNAASGQWRSYHCGNPLPYVCKKSFKEVSNLTEFWRHVNTRC
DAGWLPHNGFCYMLIHNQASWSTADQLCKANKSNLISIHSLADVELIVTKLHNDAREEVW
VGLRNEDVPTLFKWSDRTDVVFTYWDQNEPSVPFNATPNCVSYSGKLGQWRVKSCEENLK
YVCKKKGKILNETKSDKNCSLDEGWEMHGNYCYKILNTEVSFGAECNLTVTNRFEQEFIN
SLIRKHTKVEEKYFWTGLQDISQSGMYSWAAVDGEKSEAVTYTNWNSLQPEFSGGCVAMS
SGRSLGKWETKDCKTTKAFPVCKKYIGLPKEPEVLPKPSDPCPPGWHNGSGLACYKFFHS
ERVLRTRTWEEAERFCEALGGHLPSFTHTEEIKTLHSILRKIISNDRWVWVGMNKRSPDS
LGTWQWSDDKPVTSLVLPHDYLEDEYDTRDCVALKTFQFSRRSFWRFYFHEGRDLEFYFK
PFDCEAKLEWVCQITKGSTPKTPEWYIPDEIGIHGVPLVVDGAELWFVPDKNVSFQEAIS
YCQKNDSELASVESYPKLRTILSQIEKLSNSEQKWWLKFIDYGYSYHSPLQLFPRFHDRS
LRDCWYVSRKSWYRDYPVNCNMKLPFICEKNNASLLEKHDPSYRPVTGGCPKGWLRFRNK
CFLKMKSEYLTFNAANEKCVTFGGSLPCISSQAEQDFITSLLPQMPRDIWIGLQFLFSTR
ENKWIDESRLLYSNFHPLLTGRLRKIPLDLFDEEFNNQCGVILNDPKSHYVGTWNFTACA
DRHFLGICQRPIGIGAADNQTEQVLNDTFSYHNVQYKLILNNLTWNDAMAACIGQKMQLV
SITDQFQQASLAVQAALHDYPLWIGLFSRDGGKHYGWLDGKHVSFSRWSEDDEETSEECV
YLDTDGFWKTSDCYSENRGAICYSSEKKDEKEQVTQVKCPHKIKNTPWISFRNNCYTFMI
TKNRWREMKSQEAHHLCKKMNPEAFVLSVRDEEENNFVAEQLHSFSGLAVWVWLGVIYDD
SDKVLKWYDETYLTYNNWRLGRPIIKKNSFFAGVNLDGFWDIYNYSQSWQAHHYNVYSIL
ACKIERGPQQHKPPLPEFIPHGDVTYRILQKKLTWYDAVRECKQNMSDLASVHSESQQLF
LEDIVKQDGYPLWLGLSIHDGSKANFEWSDGSSFDYYPWELENSNTTENCVLLDTKGSWN
RAKCTNVAEGAICYSFSNKKQLEQKQVSRASGCSQLSGELPWIQYKDHCYAFDMAFYNFS
VYNVEDAKKVCKKLNPSAALLTIGDAEENAFVSAHIKKNDLITRKVWLGLTQSSTGQTLH
WLDGSSVNYANWDNRTTELSEKCSVITSTTGKWSKVDCSRSQSRVVCKAPLGSNHTGVAV
AFALLVILVLVLGLVWFICKKKRLHWSAFSSVHYQRGLNDDEADDVFTKDGY
Download sequence
Identical sequences F1NC84
ENSGALP00000018165 XP_015145133.1.86415 XP_015145134.1.86415 XP_015145135.1.86415 XP_015145136.1.86415 XP_015145137.1.86415 XP_015145138.1.86415 XP_015145139.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]