SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018239 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018239
Domain Number 1 Region: 998-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-105
Family Thrombospondin C-terminal domain 0.00000000503
Further Details:      
 
Domain Number 2 Region: 66-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-40
Family Laminin G-like module 0.0000114
Further Details:      
 
Domain Number 3 Region: 875-997
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.83e-36
Family TSP type-3 repeat 0.000000549
Further Details:      
 
Domain Number 4 Region: 806-877
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.84e-17
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 534-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.22e-16
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 6 Region: 478-527
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000589
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 7 Region: 733-818
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000183
Family TSP type-3 repeat 0.0001
Further Details:      
 
Domain Number 8 Region: 359-416
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000282
Family VWC domain 0.0032
Further Details:      
 
Domain Number 9 Region: 423-466
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 590-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018239   Gene: ENSGALG00000011200   Transcript: ENSGALT00000018261
Sequence length 1213
Comment pep:known chromosome:Galgal4:3:40680694:40713177:1 gene:ENSGALG00000011200 transcript:ENSGALT00000018261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGGRAPRSAPQRRQRPGSRQSPLVPSALLMPGVMLQRSRLLWLAVFITLWVSSDAQDD
AKEEENTFDLLQISNINRKTIGAKLFRGPDPAIPAYRFIRFDHIPPFKPEKLKKIVKLIR
QNEGFILSATLRQDRQSRGTILALEGPGISERQFEIISNGRANTLDLIYWVDGFQNVISL
EDVDLADSQWKNLTVQVTGENYNLYVGCDLIDSFILEEPFYEQLKAENSRMYVAKGSIRE
NHFRGLLQNIHLIFDTSIEDVLRKKGCQRSQSTEVNTINESTEILHLSPAVTTEYVGEKT
EKKAEFCDRSCEELGTMFTELTGLRIVVNNLADNLQKVSEENQIMWELIGPNKTLKNQSV
CWQDGRVFADSESWIVDSCTKCTCQDSKIVCHQITCPPVSCADPSFIEGECCPVCSHSDD
SEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSACTGPHIQTRMCSFKKCDHRIRQDGG
WSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGGKNCVGNGRETEKCEKAPCPVNGQWGP
WSPWSACTVTCGGGIRERSRLCNSPEPQYGGKPCVGDTKQHDMCNKRDCPIDGCLSNPCF
PGAECNSYPDGSWSCGPCPAGFLGNGTVCEDLDECIAVSDVCFKVNQVHRCVNTNPGFHC
LPCPPRYKGSQPYGVGLEVAKTEKQVCEPENPCKDKTHSCHKSAECIYLGHFSDPMYKCE
CRTGYAGDGRICGEDSDLDGWPNNNLVCAANATYHCVKDNCPLLPNSGQEDFDKDGKGDA
CDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDSC
AVDIDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQCDNCPLMHNPDQTDADNDLVGDQCD
NNEDIDEDGHQNNQDNCPYIPNANQADHDKDGKGDACDPDDDNDGIPDDRDNCRLRYNPE
QEDSDGDGRGDICKDDFDDDNVPDIFDVCPENNAISETDFRKFQMVPLDPKGTAQIDPNW
VIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYV
LMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDP
KNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQVMVDSGPIYDTTFAGGRLGLFVFSQEM
VYFSDLKYECRDA
Download sequence
Identical sequences E1C3P2
ENSGALP00000018239 XP_015139537.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]