SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018459 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018459
Domain Number 1 Region: 28-358
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-101
Family Glycosyl hydrolases family 35 catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 475-615
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.3e-31
Family Beta-galactosidase LacA, domains 4 and 5 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018459   Gene: ENSGALG00000011328   Transcript: ENSGALT00000018482
Sequence length 636
Comment pep:known_by_projection chromosome:Galgal4:7:21710108:21714164:1 gene:ENSGALG00000011328 transcript:ENSGALT00000018482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVMGLPALGLLLAAALLRTEAAPPARSFQIDFEQDCFRKDGAPFRYVSGSVHYARVPRP
AWRDRLLRLYMAGLNAVQVYVPWNYHEPQPGVYDFSGDRDVEAFLDLAAELGLLVILRPG
PYICAEWEMGGLPAWLLWKADIILRSSDPAYLAAVDAWLHVLLPKIKPRLYQHGGNIISV
QVENEYGSYYACDLGYLQHLLGTFRALLGPEVLLFTTDGAQVEELRCGTLQGLYATIDFG
PDSNVTEAFDAQRHVEPMGPLVNSEYYTGWLDYWGGPHASTSATLVAQGLADMLQLGANV
NMYMFHGGTNFAYWSGADFKDQYKPVTTSYDYDAPLSEAGDPTEKLFAIRTVISKFQPLP
VGPMPPPTPKYAYGRVALHKYADLLDVLDVLSPSGPIQSQFPLIFEAVKQAHGFMLYRTQ
LPYDILAPATLSAPPHSICDRGYVMLQKEYQGTLERDGQTELRVKGKAGDTLDVLLENMG
RISFGANFSDFKGLLGNLSLDSRPLSKWLIYPLAIDAAIQQGWPHAALPKSSCRGRAGPA
FYTGTFETPGIAWDTFVKFPGWSKGQLWINGFNLGRYWPRQGPQQTLFVPGSILRVGCPN
NITVLELEEAPPNPFLLFLDQPLFNTTLSHSSPDKE
Download sequence
Identical sequences ENSGALP00000018459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]