SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018862 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018862
Domain Number 1 Region: 35-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00045
Further Details:      
 
Domain Number 2 Region: 169-364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-39
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 3 Region: 335-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 4 Region: 783-960
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-36
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 968-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-28
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 578-639
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000366
Family Fibrinogen C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 7 Region: 549-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000216
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018862   Gene: ENSGALG00000011577   Transcript: ENSGALT00000018885
Sequence length 1306
Comment pep:known chromosome:Galgal4:7:23919267:24182349:-1 gene:ENSGALG00000011577 transcript:ENSGALT00000018885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPALGAVALLLAGFWHLGLTATNYNCDGALVSTLPSSAFTSSSEFFSTHSPSFAKLNR
RDGAGGWSPLDSNEQQWLQVDLGDRVEIVGVATQGRYGSSDWVTSYTLMFSDTGRNWKQY
RKDDTVWVFTGNSNADSVVHHKLLHSMKARFLRFVPLKWNVGGHIGLRVEVFGCSYKSDI
ADFDGRSSLLYRFNQKLMSTFKDVVSLKFKSMQEDGVLFHGEGQRGDYITLELQKGKLSL
HINLGDSNLHFTNSHTSVTLGSLLDDQHWHSVLIERFNKQVNFTVDKHTQHFRTKGDSDH
LDIDYELSFGGIPVPGKPGTFQRKNFHGCIENLYYNGVNIIDLAKRRKPQIYTVGNVTFS
CSEPQIVPITFVSSSRSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSENSGSLLVY
LHGGRLTLLIQKVAEDPVEISEGTNLHDGLWHSLNINARRHRITLTLDNNAATASHATTV
SRIYSGNSYYFGGCPDNFTDSQCLNPITAFQGCMRLIFIDNQPKDLILVQQGSLGNFSDL
HIDLCDIKDRCLPNYCEHGGKCSQSWTTFYCDCNDTSYMGATCHNSIYEQSCEAYRHQGK
TSDFFYIDSDGSGPLGPLRVFCNITEDKIWTAVQHNNTGLTRVQGAGPEKPYTMSFNYNS
SAEQLEAVINSAEYCEQEAAYHCKKSRLLNTPNGIPFAWWVGRANEKHLYWGGSLPGIQQ
CACGLEESCLDMRYFCNCDADREEWTNDTGLLAFKDHLPVTQIVITDTNRSNSEAAWKIG
PLHCYGDRQFWNAASFNTEASYLHFPTFHAEVSADISFFFKTTSLSGVFLENLGMKDFIR
VEIRSPKEITFSIDVGNGPTEATVQSPTPLNDNQWHYVRAERNLKQTSLQVDNLPKKVLE
APAEGHFRLQLNSQLFVGGTASRQKGFLGCIRSLHLNGQKLDLEERAKMTPGVKPGCPGH
CSSYGNLCHNGGKCVEKYNGYSCDCTSSAYEGPFCKEEVSALFEAGTSITYIFQEPYPVT
KNASTSSSAIYADAITSKENIAFSFLTAHAPSLLLYINTYFHEYLAVILSKNGSLQVRYK
LSKDGLLIFTIDSGNFANREMHHVKINREGRELIIQVDQVIKLKHNFSEIDFKAIKSLTL
GKVTDSLPLDPEVSKANAYGFTGCMSSVWYNHVAPLKAALRHPSIAPVTVKGSLTESSCS
SLMETDVNTATTIYSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIAIMSR
FLYQHKQAHRSSQTKEKEYPENLESSFKADIDLQNTVSECKREYFI
Download sequence
Identical sequences F1NW79
ENSGALP00000018862 9031.ENSGALP00000018862 XP_015145306.1.86415 ENSGALP00000018862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]