SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018963 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018963
Domain Number 1 Region: 397-546
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.07e-41
Family Mannose 6-phosphate receptor domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 705-840
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.9e-40
Family Mannose 6-phosphate receptor domain 0.00024
Further Details:      
 
Domain Number 3 Region: 246-393
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.33e-35
Family Mannose 6-phosphate receptor domain 0.00000335
Further Details:      
 
Domain Number 4 Region: 1146-1289
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-34
Family Mannose 6-phosphate receptor domain 0.00096
Further Details:      
 
Domain Number 5 Region: 843-1000
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-33
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1294-1430
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.75e-33
Family Mannose 6-phosphate receptor domain 0.00014
Further Details:      
 
Domain Number 7 Region: 2056-2195
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.14e-31
Family Mannose 6-phosphate receptor domain 0.00087
Further Details:      
 
Domain Number 8 Region: 1583-1717
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.15e-31
Family Mannose 6-phosphate receptor domain 0.0000126
Further Details:      
 
Domain Number 9 Region: 1436-1575
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.72e-31
Family Mannose 6-phosphate receptor domain 0.0024
Further Details:      
 
Domain Number 10 Region: 555-696
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.2e-30
Family Mannose 6-phosphate receptor domain 0.00099
Further Details:      
 
Domain Number 11 Region: 1720-1864
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.16e-30
Family Mannose 6-phosphate receptor domain 0.0004
Further Details:      
 
Domain Number 12 Region: 114-238
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-27
Family Mannose 6-phosphate receptor domain 0.0000126
Further Details:      
 
Domain Number 13 Region: 2202-2348
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-26
Family Mannose 6-phosphate receptor domain 0.00093
Further Details:      
 
Domain Number 14 Region: 1873-1965,2013-2058
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.23e-22
Family Mannose 6-phosphate receptor domain 0.0023
Further Details:      
 
Domain Number 15 Region: 1006-1147
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.2e-19
Family Mannose 6-phosphate receptor domain 0.0021
Further Details:      
 
Domain Number 16 Region: 1965-2013
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000999
Family Fibronectin type II module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018963   Gene: ENSGALG00000011621   Transcript: ENSGALT00000018986
Sequence length 2561
Comment pep:known chromosome:Galgal4:3:44773338:44826366:-1 gene:ENSGALG00000011621 transcript:ENSGALT00000018986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPLPTTVKRNHRPQHVPSGAVRGAGRKRSHTPRPPPGGRARHVIAMPAHDGGHMTRQW
AGGGHMTCRWRPALLDVPGQPLRPGPARAAAMARAAFAPLLLVLLCLPLGDGVAAPVSPN
KPFFQDLCSYTWEAIDTDKHVLYKINLCFGVEECGRSSAVCAYDVDKRAYMSVGSLTLRE
ISKTLLVFNTTSKCSQQGSEHRIQSNINFLCGKTLGTPEFVTATECVHYFEWRTFVACKK
NLFKPVKEVPCYVFDEDLKKHDLSPLIRVPGHYLVDDSDNDSLFINICRDIGRSSGETMN
CPAGSAACLIHEGHAYDVGRPQDQLKRHDKDRLILSYERTYNDEKLNFCLGHNPAVTITF
VCPSKRGEESAGPKLTAKTNCRYEVEWVTEYACHRDYLESKSCVLTNEQHDVSIDLSPLT
LSPDYVTPYLAKDDKEEYYYYLNVCGRTGAGNCEGSMTYTSACQVKSSTNQKKVTGRFEN
QTLRYSDGDLTLIYPNGDACSSGFQRMTVINFECNETAGNDGRGTPVFTGEVDCTYFFTW
YTKYACVKEREDLLCRVADKKKHYDLSPLIRSSESAQNWEAVDSNLSEEWRKRYYINVCH
KVLKRGGASGCPDAAAICSVDKKNNSKNLGTFVSPPKKVGENIQLTYSNGGSCGGNKKIK
TVITLICRPGDLESAPILISEGVCSFTFDWYTAAACVLSKMEGDNCQVSDPQAGFSFDLS
PLTKKNGHYTVNTEEYLFYINVCGSVPNELCHTQSAACQVTQRKDQFWSLGLPNSRLSYY
DGLIQLTYKNGTAYNNEKKTQRSTLITFLCDRQAGIGQPEYQVEDNYTYNFRWYTEYACP
EMPLECIVTDPNTMDQYDLSSLAKSEKRGENWYAMDNSGPNERKKYYINVCRPLLAVPGC
DRRASVCQMEYRHDHDSYYEVTSISNLGVASKELVVERLGHILLTYANGSVCINADGERT
SYTTTIHFVCSRGTLNSSPRFISIQECVVTFLWETEAACPIKETKDDSQSCSVRDPNSGF
LFNLQPLAAEKGYTTTGIGKTYLLNICEAMPECGKINGKPAAGCEADNLTSVRMVELDKT
LYLSSEGFLTLTYRGPLLVESGKSDTFTVTFICNDSYPGELKFVREEINSMLNIHDTFFE
FHTALACAPAPVDCQITDAAGNEYDLSDLSKEGKPWVAIDTSKDAKKRTFFLNVCKPLPF
VPGCPGGAIGSCVKYADKSKNLGVIQINPQAATDGSLSIIYLNGDMCKDKRRYSTRIIFQ
CDQTMGSPVLEQEDNCEFVFVWRTLAACPVHKAEGEDCQVKDPRYGHVYNLKPLSSKDIK
VSTDEYDYYFRVCGEITEHCRPGAHSVSSCQVKKTDSTFRKVAGLLTEKLTFKNGLIMIN
YTSGEKCHKIYERSTAILFYCDKTTSEPVFLKETPDCTYMFEWHTQYACPPVKSTECSYR
DDEGNFYDFSSLTRHRENWEATDISTSTKIYYINVCKPLVPYGAAHSCPPDAAASLVEGI
KCVSLGEVAEGPRWENGISTLKYINGELCPDKIRRKTTILRLKCDESKIESKPELIMAIE
DCEYSFLWFTAAACPLKSNVQNDCRVTNPATGHLFDLTSLKRESGYTITDSHNRKIELNV
CAEAKSSCANGAAVCITDGPKTLNAGKLSKTLTYEDQVLKLVYEDGDPCPTDLKMKHKSY
FSFVCKSDAGDDSQPVFLSFDEQTCTSYFSWHTSLACEEEVSCSVLNGSSVIDLSPLIHR
TGYYEAFVDGDQSDVSPDFYINICEPLNPIKDVNCPPGAAVCMVPVNESPIDIGRVTEPP
KLNEAVNEVYITYNSTTPCQINNKLNYTSLIVFHCSQGTSLGKPKMIQKLDCSFVFEWET
PVVCPDRVKTLGCSVTDEQLHYTFNLTSLSGRSFEVLSGSSRYHVSVCSKAAADVSQGKC
KDGAVCMTSGSGVSSFGSIKEMKMNYSRQDETVILQYTGGDRCPPVTEKGELCVFPFKYK
GKSYDKCITEEKNRPWCATAVDYQGDGKWGFCVNATARRASTIIFVCDENAGSGSPRLLS
DMLGCAVTFEWRTQAVCPPKKMECKFVQKHRTYDLRILSSLTGSWVFYHNGNSYYLNLCQ
RVYEGPTGCPERASICRKSNNGDVEVLGLVHTQKLNVTGDTVYISYSGGQECGKNKKIMT
IIELRCAKTVGMPMLQRFDEENCAYFIIWDTRAACAVKPQEVEVVNGTVINPATGKNFSL
GDVYNKLYMASGDIRTNGDQYVYEIQLSGITNSSFPECSEANICQVKTSERRFRKIGWAK
KAKYYVEDDDLDVIFSSDSRCGKDKSKFVSSSIFFHCSPHVQEGIPEFLHETADCQYLFT
WYTSAVCPLISTIAPGIHGGQSDQEAQVYKGLSRRSQAVGAVLSVLLVVLTACLIILLFY
KKERRETVVNKITNCCRRTSGVSYKYTKINSEEEANENETEWLMEEIAAPNQRTVKGVQE
NGHVTTKSVTSDAFTSLHVDDLDSEDEVLTIPDVKIQTGRGLDKSKHPQKKPPRFASDDK
AYLLNGGKERKAKAKPGQQQAQNSTNSVSFHDDSDEDLLNV
Download sequence
Identical sequences ENSGALP00000018963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]