SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019082 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019082
Domain Number 1 Region: 53-501
Classification Level Classification E-value
Superfamily Sema domain 6.93e-144
Family Sema domain 0.0000000569
Further Details:      
 
Domain Number 2 Region: 794-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.16e-16
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 848-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000068
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 4 Region: 606-656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 5 Region: 497-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000576
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 660-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000497
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 7 Region: 906-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 551-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019082   Gene: ENSGALG00000011686   Transcript: ENSGALT00000019105
Sequence length 1066
Comment pep:known_by_projection chromosome:Galgal4:7:26051937:26233120:-1 gene:ENSGALG00000011686 transcript:ENSGALT00000019105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVSRLKAISLSLPSLFLLAFHLSASQNVPEYSEAEHQQCVRKEHPTIAFEDLKPWVSNF
TYPGVHDFSQLALDANRNQLIVGARNYLFRLSLHNVSLIQATAWGSDEDTRRSCQSKGKT
EEECQNYVRVLIVYGKKVFTCGTNAFSPVCSSRQVGNLSKIIDRINGVARCPYDPRHNST
AVITSRGELYAATVIDFSGRDPAIYRSLGNVPPLRTAQYNSKWLNEPNFIAAYDIGLFTY
FFFRENAVEHDCGKTVYSRVARVCKNDIGGRFLLEDTWTTFMKARLNCSRAGEIPFYYNE
LQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRSAWLPTAN
PIPNFQCGTLSDDSPNENLTERVLQDAQRLFLMNDVVQPVTVDPYVTQDSIRFSKLVVDI
VQGKDTLYHVMYIGTEYGTILKALSTTNRSLRSCYLEEMQILPDGQREAIKSLQILHSDR
SLFVGLNNGVLKIPLERCSMYRTEGECLGARDPYCGWDNKQKRCTTIEDSSNMSLWTQNI
TECPVKNLTTNGRLGPWSPWQPCEHSDGDSTGSCMCRSRSCDSPRPRCGGRSCEGARIEV
ANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRYGGRVCVGQSREERFCNENSP
CPLPIFWSSWGPWNKCSVNCGGGIHSRQRTCENGNTCPGCAVEYKTCNPESCPEVRRNTP
WTPWMPVNITQNGARQEQRFRYTCRAQLSDPHELQFGRKKTESRFCPNDGSAMCETDSLV
DDLLKTGKTSARIINGGWSFWGAWSSCSRDCELGFRIRKRTCTNPEPKNGGLPCVGSAME
YQDCNPHPCPVKGSWSCWTPWSQCSATCGGGHYQRTRTCTNPAPSSGEDICIGLHTEEAL
CNTHPCEGGWSEWSEWSLCNEEGIQYRSRYCEVHSPDSSQCVGNSTQYQDCLYNEIPVIL
PASSIDESTNCGGFSLIHLIATGVSCFFGSSLLTFVIYVYCQRCQRQSQESTVIHPTTPN
HLHYKGNTTPKNEKYTPMEFKLTEVTHLISGGPNLDIYQWRWRSDT
Download sequence
Identical sequences A0A1D5PWJ8
ENSGALP00000019082 XP_015145478.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]