SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019234 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019234
Domain Number 1 Region: 154-167,206-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-63
Family Nuclear receptor ligand-binding domain 0.00000000227
Further Details:      
 
Domain Number 2 Region: 103-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-26
Family Nuclear receptor 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019234   Gene: ENSGALG00000011801   Transcript: ENSGALT00000019259
Sequence length 472
Comment pep:known chromosome:Galgal4:5:52910592:52952314:1 gene:ENSGALG00000011801 transcript:ENSGALT00000019259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFCSPAMLNYNIASNFGDSESASVRQTSSPSVLWSAPGHLSPLTLHCQSSLLYAEQPKS
PWCEVRPLDPVLPVTRETLKRKTNGSDCTSPIASNPGSKRDAHFCAVCSDYASGYHYGVW
SCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCGSRRERC
GYRILRRHRNSEDCMGKTKKYNEAATRVKEILLSTVSPEQFVLTLLEAEPPNVLVSRPSK
PFTEASMMMSLTKLADKELVHMIGWAKKIPGFIDLSLYDQVRLLESCWMEVLMIGLMWRS
IDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLAMTSRFRELKLQHKEYLCVKAMILLN
SSMFPLSAEEPESNRKLHHLLNVVTDALVWVIAKSGIPSQQQTTRLANLLMLLSHVRHAS
NKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGQRKSPVTHPEFEQVSHFQV
Download sequence
Identical sequences F1NMB7
ENSGALP00000019234 9031.ENSGALP00000019234 ENSGALP00000019234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]