SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019244 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000019244
Domain Number - Region: 467-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Merozoite surface protein 1 (MSP-1) 0.023
Further Details:      
 
Domain Number - Region: 282-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0643
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019244   Gene: ENSGALG00000011806   Transcript: ENSGALT00000019269
Sequence length 627
Comment pep:known_by_projection chromosome:Galgal4:7:27422611:27442038:-1 gene:ENSGALG00000011806 transcript:ENSGALT00000019269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRCMFFTVLLCLVLSLSEGTTSTIPESSSTIAAVKPGEGNESEATENSTASPPSPLATG
NESKATENSTASPPSPVATGNESARTDNSTVTPSSPVTAGNESAGTENSTATPSSPVTAG
NESAGTENSTATPSSPVTAGNESAGTENSTATPSSPVTAGNESAGTENSTATPSSPVTAG
NESAGTENSTATPSSPVTAGNESAGTENSTVTPSSPVTAGNESAGTENSTVTPSSPVTAG
NESAGTENSTVTPSSPVTAGGTSTTTLETSTTSPTPAPEELCKPNPCGGRLSICVPLNTT
HICQCPYGLYYYKNNCYTGKVFPGIITLEQMLSNIDVNSAEYERMVQNITEFFKDAFENM
TDYKQTVIVKVDFKETAPGTRSANYLVNVTVMNIFTENATETDFEVQEAVRTAAENLNYV
RQYANTSQCAVYPCDDATTICEDGTYPACVCKKDFTKTAWDTYSCSGCADCSAEANKFCD
RQSGIPECKCMDNFKADGGKCVRCPVGYSGENCENNKELILIIVGTVFGAIILCLVVAVS
VVSVRAKHSHDPEKKRLIKPGNSNSNNSEETRIFPRVQTTSGHANPGYQPNNPYEVHSSS
RGDFVEKDYDDLYEISRQPEGFRMQRR
Download sequence
Identical sequences ENSGALP00000019244 XP_015145457.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]