SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019363 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019363
Domain Number 1 Region: 66-198
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-33
Family C-type lectin domain 0.000000795
Further Details:      
 
Domain Number 2 Region: 46-73
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000288
Family Triple coiled coil domain of C-type lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019363   Gene: ENSGALG00000011883   Transcript: ENSGALT00000019389
Sequence length 201
Comment pep:known chromosome:Galgal4:2:43675442:43682092:-1 gene:ENSGALG00000011883 transcript:ENSGALT00000019389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRGACLLLCLVSLAHISVQQNGKGRQKPAASKKDGVSLKMIEDLKAMIDNISQEVALL
KEKQALQTVCLKGTKIHLKCFLAFSESKTYHEASEHCISQGGTLGTPQGGEENDALYDYM
RKSIGNEAEIWLGLNDMVAEGKWVDMTGSPIRYKNWETEITTQPDGGKLENCAALSGVAV
GKWFDKRCKEQLPYVCQFMIV
Download sequence
Identical sequences Q9DDD4
NP_989997.1.86415 ENSGALP00000019363 9031.ENSGALP00000019363 ENSGALP00000019363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]