SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019565 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019565
Domain Number 1 Region: 532-788
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.74e-82
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 192-296
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000463
Further Details:      
 
Domain Number 3 Region: 413-514
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 4 Region: 299-401
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 80-186
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019565   Gene: ENSGALG00000012004   Transcript: ENSGALT00000019591
Sequence length 789
Comment pep:known_by_projection chromosome:Galgal4:4:54423627:54470738:1 gene:ENSGALG00000012004 transcript:ENSGALT00000019591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELWRPGLTAELKVRAGLRVPERGGGVGIPRAAPPSRSLEGLRVEGGDERLSPFATVT
TEGFLRGGFKLFHQQLHRQDEVSVRLQGGKNEFEGTVEVYLNGVWGTICGSHWDNNDATV
ICRQLALGEKGTSKHIPFSELGLIPVYWSEVRCRGDEENILLCEKDIWQDGICPQNTAAA
VTCSSSLASVFTPIRLAGGNKAYEGRVEVYHAGQWGTICDDQWDDADAEVVCRQLGLGGA
AKAWSQAYFGEGSGPVLLDEVQCTGNELSIEQCPKSSWREHNCDHKEDAGVSCTPLTDGA
LRLTSGKGSHEGRLEVYYSGQWGTICDDGWTELNTQVACRQLGFKYGKSVPESSSEGNSG
PIWLDDVSCSGKETNLLQCSRREWGKHDCSHQEDVRLICHPDNNSHKLSLGPPIRLMDGE
NKKEGRVEIFFNGQWGTICDDGWSDKDAAVVCRQLGYKGPARARTMAYFGEGKGPIHVDN
VKCTGSERSLADCIKQDIGTHNCRHSEDAGVICDHLGKKVPGNSNKDSLASVCGLRLLHR
RQKRIIGGKNSLRGGWPWQVALRFKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTR
NYAVRVGDYHTLVPEEYEEEIGVQEIVMHKEYRPDSSDYDIALVRLQGPEEQCARFSTHV
LPACLPLRRERPQKTAPNCYITGWGDTGRAYSRTLQQAAIPLLPKRVCEERYKRRFTGRM
LCAGNIQEQKRIDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGMKDSPGVYTKVSSFV
PWIKSVTKL
Download sequence
Identical sequences F1NH25
ENSGALP00000019565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]