SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019739 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019739
Domain Number 1 Region: 91-243
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-36
Family C-type lectin domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019739   Gene: ENSGALG00000012102   Transcript: ENSGALT00000019766
Sequence length 256
Comment pep:novel scaffold:Galgal4:JH376323.1:8190:14563:1 gene:ENSGALG00000012102 transcript:ENSGALT00000019766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFFSFPPRSLREVLAKKSAPPAPLCPQPDPSLPLSPHTMGAVPHLRAAMEERERLSTS
PPEATTREGDEERQSQRGSRCSELRQNRRRVLCVALCAVPCILVSALVAVIVLQRPSCSP
RPPFSHVCPNTSIGFQGKCYYFSDTESDWNSSREHCHRLGASLATIETDEEMEFMLRYRG
PANCWIGLHRAEGDEHWTWADGSAFTNWSVFELRGGGQCAYLNGDRISSALCHNEKFWVC
STADSYVRWKQKALPD
Download sequence
Identical sequences ENSGALP00000019739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]