SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020164 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020164
Domain Number 1 Region: 580-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1228-1285
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 171-218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000562
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 984-1027
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 5 Region: 1036-1106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 319-372
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 7 Region: 646-715
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 8 Region: 1350-1414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000011
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 9 Region: 720-773
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 1112-1159
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 1161-1216
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000929
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 12 Region: 382-461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 13 Region: 1283-1334
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000458
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000020164
Domain Number - Region: 905-979
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000327
Family TSP-1 type 1 repeat 0.0099
Further Details:      
 
Domain Number - Region: 779-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0094
Further Details:      
 
Domain Number - Region: 40-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00327
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 851-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00366
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 
Domain Number - Region: 463-525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0445
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Domain Number - Region: 101-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0772
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020164   Gene: ENSGALG00000012362   Transcript: ENSGALT00000020191
Sequence length 1590
Comment pep:known_by_projection chromosome:Galgal4:7:30459507:30701723:1 gene:ENSGALG00000012362 transcript:ENSGALT00000020191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQQNWVSPRWTWQSLGKSFIFFVFLMLQAADLEARRGHQFVWKTGHWGRCVGDCGSGG
TRSRAVWCTHTEGWTSHHANCDQQEKPESQRRCFKVCDWHLELFEWDVSGWGSCEPGGEA
GPCVMAQHGLQRRSARCLQKLDRSVVAAEICEHLAPQPPLEQACLVPCPRDCVVTDFSPW
SPCSGGCTNSLRHRTRAVIAPPLYGGAPCPNLTESQTCAAAACPLGEEEHTYSLKVGPWG
ECRLPHREDASLDLGEDSGELSTSWLEGHKAQHHPHTGQVGYQTRAVSCVRSDGRHAVLS
LCVQDAVPLTSKTCVIAKDCETSEWSAWSSCSQTCSWGDLAPGFRSRHRSVRSVAMGSGK
LCPELEEKEACSTGGRELLKPCPRFSWRTSEWKACQVSLFDQQSPQHHKHAVLCGGGIQT
REVYCVQITVEGETHRLKEVSRPVDGKFCLGPAPSASQLCDLPCPLECAVSAWLAWGPCL
PEDCRDRQGRRGFRMRQRHVIVDPVGTLTGCPHLVESIPCEDPTCYEWIVSEGICVADHG
KCGPGKHILKTVCKNKKGEEVPYHLCSELPRPDVMACEIPCATDCVLSEWSQWSPCSHSC
SSKSAEGSQSRSRSILALPAEGGKACPPDRALQEHRACNDHPCVHFFWETSPWSSCSEDV
LVTALNATVSWSGEATCGVGMQTRKVFCMRSGSGHVTPKRCPDSTRPETVRPCLLPCKKD
CIVTPFSEWTRCPTVCQPGNATAVKQSRYRIIIQDAANGGQACPDTLYEERECEDIPVCP
VYRWKTHRWSHCVLVPESVRQNVLGHNEACGHGLQSRAVTCLTENNESADVSECMKWAGP
MPPLVQDCLIPCKDDCTFTPWSKFTACSFDCESTKTRRRSLTGRSRKRDKCQNTEVYPQV
ETELCPCEVFTSQPHGNWSDCIIGGGKLELQQGVQSHGDTKECGEGVRLRAIACYDKAGR
LVEPSRCSSSGYVEESCTVPCPFDCKLSDWSSWSPCSSSCGTGMKVRSKWLKEKPYSGGR
PCPKLDLKNQVYEAVPCYTECNQYSWVVEPWSPCKINSEQNSLHCGEGIQTRKVRCVSTT
EDHGGETVPNTLCNKAEIPNEIRKCSLYCPNECAVSDWGPWSTCPQVCDPSTVQTRTRQV
LRSVSRKPCPEDSQMKPCILNQNCFQYQYNLTAWSTCQLNGNATCGRGVRKRLLSCVRSD
GETVSARHCEQRRLEKPAETSSECVVRCVVDCRLSAWSAWSQCSQTCGSGGQMVRGRTVL
LKAAAEGRPCPAQLSQHRSCPVKPCYSWHLGPWSPCRLQGGQCGDGLQFRNLTCVVHDAS
VSATSQPVEDALCGELPLKESVLQLPCSVPCPGDCHLTEWSEWSSCELTCIDGRSFETTG
RQARSRALIGQPAENTESCSGQVVETRPCSGGRCYEYLWKTSLWRDNVRTVWCQRSDGVN
VTGGCALQTKPAEVRHCSPACRKPFSYCTQRGVCGCERGYTEIMRSNGLLDYCMKVPGLE
DKKADVKTIAGKNKPVNSKMHDIFKGWSIQPFNPDGKLKMWVYGVSASGFLIIVLLIFTS
FLMCKKSKQHQSTPPQQKPLTLAYDGDIDM
Download sequence
Identical sequences XP_015145383.1.86415 ENSGALP00000020164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]