SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020214 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020214
Domain Number 1 Region: 361-581
Classification Level Classification E-value
Superfamily GFP-like 3.77e-76
Family Domain G2 of nidogen-1 0.00000144
Further Details:      
 
Domain Number 2 Region: 947-1204
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-43
Family YWTD domain 0.0000000848
Further Details:      
 
Domain Number 3 Region: 733-848
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.06e-24
Family Thyroglobulin type-1 domain 0.0006
Further Details:      
 
Domain Number 4 Region: 853-924
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.15e-22
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 5 Region: 318-358,594-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.16e-18
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 6 Region: 683-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000309
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020214   Gene: ENSGALG00000012394   Transcript: ENSGALT00000020241
Sequence length 1215
Comment pep:known_by_projection chromosome:Galgal4:5:57989689:58008203:-1 gene:ENSGALG00000012394 transcript:ENSGALT00000020241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKAGGGTSRGGSDGVTFPVGTNGVISTQDFPGETQYVDDDFPTDFPVIAPFLADLDTSG
GRGDIYYRQDRAPTVLEWAAGYVHAGFPDTAGTFVPSSAFIATWEDVGAHGEPPGKLNTF
QAILAYNEEETYAIFLYPEGGLQFLGTRPKESYNVQLELPARVGFSRGDGDDGKREGHSY
SVASSQQELQRLERESNVGVPGVWVFRVGTLENVEPGDVPGAALSPAPHGTDDTSVPTEL
LAQPGSRTTSPHPHPALLSIVPSGLPASPLGQEWSPRLHSIGDAPQGHPVSYSSGQHGVG
VEEDVHFNTNVFTYSAGSRETCAQHHGRCSPHAFCTDYATGLCCHCRAAYYGNGRQCLPE
GAVHRLNGKVSGSLVVGRTPVRFQDVDLHAYIVGSDGRAYTAISGVPAPAARALLPLLPL
GGLFGWLFALEEPGSENGFSITGAEFTQYLEVTFYPGEEQVRITQMAEGLGADNYLSLRT
HIEGQVPFVPENTSVHIAPYKELYHYSSSAVTSSAHRDYVLTSGSTNQTLSYRLRQNITV
VGCPHARGRLPTVQQLSVARAFALYDGHEQVLRYALTSRISSSRGDAEVPPVNPCHDGTH
ACEETARCQPGTGLGYTCECAAGYRGDGRGCQDVDECEEGLGQCGPFSVCLNVLGSYRCE
CHSGYRPAEDGHGCVLPTPAADPCEVGRHPCAPRDRARCLPRAGGQPACECLPGYAGDGR
VCSDVNECTLNLCHPAAICYNTPGSFSCQCQPGYEGDGFQCTHGVSLPAGSSQQLTPCEH
ERLYPRAVPPGPSPVGNGHVPQCDEQGNYRPLQCHGSTGYCWCVDGAGQEIAGTRTAPGS
TPLRCGNPAEPSERPPTMCERWRQSLLEHYGGSPRGDQYVPQCDAHGHFTPLQCHGDSGY
CWCVDESGREIQGTRSEPGSPPPCLPSVAPPTVRPSPRPDVSPPAAGTFLLYAQGQQIGY
LPLNGTRLQKEAAKTLLSLHGSIVVGIDYDCREKTIYWTDVAGRTISRASLEPGAEPETI
INSGLISPEGLAVDHLRRAMFWTDSGLDKIERAQLDGSERRVLFDTDLVNPRAITVDPVR
GNLYWTDWNREAPKIETSTVSGANRRVLVNTDIGLPNGLTFDPFSKLLCWADAGTKKLEC
TFPDGAGRRIIHNNLNYPFSIISYASHFYHTDWRRDGVIAVNKETGSFTDEYLPEHRSHL
YGITAVYPYCPGARK
Download sequence
Identical sequences ENSGALP00000020214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]