SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020364 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020364
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-39
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 36-131
Classification Level Classification E-value
Superfamily C-type lectin-like 4.85e-36
Family Link domain 0.00000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020364   Gene: ENSGALG00000012481   Transcript: ENSGALT00000020391
Sequence length 275
Comment pep:known chromosome:Galgal4:7:34630769:34644425:1 gene:ENSGALG00000012481 transcript:ENSGALT00000020391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALIFFSALLWDEAQAWGFKDGVLHNSIWLERAAGVYHRESRSGKYQLTYAEAKAVCEY
EGGHLATYQQLEAARKIGFHVCAAGWMAKGRVGYPIVKAGANCGFGRTGIVDYGIRLNRS
ERWDAYCYNPNGKECGGVFTDSKHVFKSPGYPNEYENDQICYWHIRVKYGQRIHLQFLEF
DVEDDTACMADYLEIYDSYDDINGFVGRFCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIRYVTIDVPSKAGDGKNTTSQGKANFLSGKFGIM
Download sequence
Identical sequences Q155F6
ENSGALP00000020364 9031.ENSGALP00000020364 ENSGALP00000020364 NP_001032926.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]