SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020367 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020367
Domain Number 1 Region: 526-786
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-91
Family Eukaryotic proteases 0.0000586
Further Details:      
 
Domain Number 2 Region: 311-427
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000955
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 57-155
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000115
Family SEA domain 0.0087
Further Details:      
 
Domain Number 4 Region: 219-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000602
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 5 Region: 469-501
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 435-467
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020367   Gene: ENSGALG00000012483   Transcript: ENSGALT00000020394
Sequence length 787
Comment pep:known_by_projection chromosome:Galgal4:1:51317877:51335342:1 gene:ENSGALG00000012483 transcript:ENSGALT00000020394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEQEEDASSLSKSDSETNLRVCLRYVSLGIVFLLLAGAAAATWYFLDYKPWHLEPTI
LHFYSGSLQVLNRRYFSELGQVESRAFWLESAKLQNMLKDLIHSTELGRYYNSSTVYAFG
EGALTFFFWFTLQIPESQQKEMTAERVNAVLHQELTTSFNSSGSLSYQAEYRVNPDSLIL
LESTVKDIVVLKSTLGCYRYSYVQEDDILRLEGPDYLASSCLWHLHSLKGYMIKLRLEWT
LPDCRDRLAMYDAAGPLEKHLITSIYGCSRQEPVVEVLSSGPVMSIVWKKALYSYYDPFV
LSAQVVPLKACGVNITLREGLELQGKISTPHYPSYYSPNTQCTWHMSVPSLDYGVTLWFD
AYALSRQKQDLPCTQGQWIIQNRRLCGLRTLQAYAERIPVTSSADIAITFTSQISLTGPG
VQAAYSLYNQSDPCPREFLCSVNGLCVPACDGIKDCPNGLDERNCVCPAKFQCQEDSTCI
EFSRVCNQQRDCVNGSDEEQCNEGVPCSPFTHRCDDGTCVKKPNPLCDATVDCKDLSDEK
HCDCGLQAPLSRIIGGANSVEGEWPWQASLQVRGRHICGGTLIADRWVVSAAHCFQDERL
ASPSVWTIYLGKYFQNTTSHTEVSFKVIRLFLHPYYEEDSHDYDVALLQLDHPVIISPFI
QPICLPATSHLFEPGLHCWITGWGALKEGGHISNILQKVDVQIIQQDICSEAYHYMISPR
MLCAGYNKGKKDACQGDSGGPLACEEPSGRWFLAGLVSWGMGCGLPNYYGVYTRITQVLG
WMNQTMS
Download sequence
Identical sequences ENSGALP00000020367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]