SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020441 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020441
Domain Number 1 Region: 516-576
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000119
Family BSTI 0.062
Further Details:      
 
Domain Number 2 Region: 132-192
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000159
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 896-956
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000016
Family ATI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020441   Gene: ENSGALG00000012531   Transcript: ENSGALT00000020468
Sequence length 1008
Comment pep:novel scaffold:Galgal4:AADN03018760.1:360:10879:1 gene:ENSGALG00000012531 transcript:ENSGALT00000020468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGNSNGDPQDDALLPDGTLAQNAVVLGQVWKVLGDNRICLDSCSGECKRCSWRETAKYN
TESYCGLLTQNPGPFQGCHDTIHTDIYLKNCISDLCSYEGLHTVLCQALNAYVESCQEEG
VVLADWRTAARCFPFCPVNSNHTSCGTACPTTCNDAAVPSDCISSSCVEGCTCTEGFVLD
AGKCIPKSECGCVFGDRLYGLGEEFWGDDGCTKRCVCEKERRKAVCHQASCRAKEECGVK
DGIRGCYPTSYGVCTAVGSTHYRSFDGKWFAFQGTCFYQLVGLCKRSAGLVDFQVLVQNG
LEDGGSPSFITIVRVKVYGNIITFNQTNPNKITVNDRLANLPYSHDGKILIYRGGRDVVI
ETDFGLTITYDWSGDVGVSVPSTYEDTLCGLCGNFNGDTGDDMMLKNGHVTSNPKTFGQS
WKVADHPGCTELSTKECPSSVSTVEQEKLCGIISRKDGPFRGCHTTVEPSKYVQNCKNDL
CLYPEHKEVLCQHIAHYVDLCQAAGVTIEEWRTNDFCRISCPAHSHYELCALDCSRTCSS
IFAPLRCTERCREGCVCDEGFVFSGDECVPMARCGCLHHGSYYKVEEHFRPTKLEECECH
ADGMVDCHKIPAPTESSCQGVGEGHQCPTATSGTCVVTGDRSYLSFDGTAFDIPGACAYV
LTESCSGDDDTEHFVVKIKKNSRQKTKVSGIEVLSVEVYGLTLTMERGKIGTVMGLPAIL
HQGQVQVHRHGEGIHLQTAFGLVVRYDFYHYVAVTAPPGYQGRLCGLCGNNNGKSEDDFL
FPDGHPAPNAIAFGSAWKMPTMACEESCSEDDCPVCTEEKKKVFQKPNYCGILTDPHGPF
SSCFNTVSPTLYLDACIRDLCLTKAKTDVLCRSIQSYMSSCQAAGVTIEAWRKPSFCFPR
CPANSTYSLCSNLCTNSCAKPTGTSGCPQTCAEGCSCNEGFAFNGERCVPKEECGCFVDG
IYYRPNQSVLKENCQQRCTCIPGKGLDCSSHECTDDETCEIRDGIMGC
Download sequence
Identical sequences ENSGALP00000020441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]