SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020451 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020451
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-72
Family Nuclear receptor ligand-binding domain 0.000000000117
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020451   Gene: ENSGALG00000012538   Transcript: ENSGALT00000020478
Sequence length 598
Comment pep:known_by_projection chromosome:Galgal4:7:35531192:35536596:-1 gene:ENSGALG00000012538 transcript:ENSGALT00000020478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYNSSYDVKPPCLYQMPLSGQQSSIKVEDIQMHGYQQHGHLPPQPDDVMAHSGSV
YYKPSSPPTPSTPGFQVQHGPVWDDAGSLHNFHPNYVATTHMIEQRKAPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNAEPAGPHHGVDGQPFAVPSPIRKQPAMAFPGLPLGHA
PQLLDSQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFTDLPKTDQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences E1C6K9
9031.ENSGALP00000020451 ENSGALP00000020451 ENSGALP00000020451 XP_015145688.1.86415 XP_015724696.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]