SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020568 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020568
Domain Number 1 Region: 1174-1340
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-77
Family Endostatin 0.00000021
Further Details:      
 
Domain Number 2 Region: 8-204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-32
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 3 Region: 821-986
Classification Level Classification E-value
Superfamily C-type lectin-like 4.8e-23
Family Endostatin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020568   Gene: ENSGALG00000012616   Transcript: ENSGALT00000020597
Sequence length 1347
Comment pep:known_by_projection chromosome:Galgal4:2:55950088:56021349:1 gene:ENSGALG00000012616 transcript:ENSGALT00000020597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TERGSKEHLDLTELIGVPLPPSVYFVTGYGGFPAYSFGTDANIGRLTSAIIPLPFYRDFA
IVVTVKPNSDRGGVLFAITDAFQKTIYLGIRLSPVDESTQRIIMYYTEPGSSISREAASF
KVPVMTNRWNRFTVTVQGNNIALFMDCEEYQRVQFQRSDRALVFESGSGIFVGNAGATGL
EKFTGSIQHLTIRADPRATEDHCEDDEPDASGDISGNGSVQEYEGIPETQEELVPSHLLP
EDSLAEAVEAPPTILSYLEENDFSGHHRAEETSEPANTVIIQLISHFSPYSVIVETGQSN
RESTALMQKILREEDSSGASVSLGVSREHTKPEVASFILECPLITAKLTSRDRIYPEARV
LSCENLSAPLGIEPEPVNAERIIKILIRVERDVCPESFMPTRLFLILLQDSQGEDNSVFF
SSSSSLSDVSVSSTEKDTWVVENEKQKFILTRTVLATTDKLKPEELGSGYADREIEILKT
VDDPFFFFFFSNSTVSQRNINICLIPSIQKCFVGNTGDAGKKCEKGRGQKRTTVKKEHSC
QVKFESWGINLYLATSIEEISGEIPNHFPLFSDPLNSFQGSPGLHGHPGKPAPDSDVGLP
ESPGEDGSAGELGPEPQRPPGLPGLDGVVGPPGQKGEKGDRGLPGSVGAKGDTGVTGPIG
PKGEAGADGAPGKPGPPGPPGPPGPPGPTGVSYSLGFEDLRATTVLQVLQEQIILLPTTA
KGPKGEKGDPGPQGEPGKNGNDIVGPPGPPGPPGPIIAIPELFLNDTKGILNFTAIEKLF
GPPGPDGKPGLPGFPGPRGPKGDIGLPGLKGLKGQQGEKGESGAVIAADGSLTELLGRKG
QKGEAGVVGPMGPMGPIGPAGPKGELGFPGRPGRPGLNGLKGVKGERGEALNGIPGLPGP
PGPPGPPGHIVHIKGAVFPVSPRPHCKNTVTNTYPGNQKVLNVHGAKGNGDCWSLSNSVD
LKGEKGNRGAPGPPGPPLPPSYFSHFINTMKGEKGDNGVKGEKGEPNGGFYLTGPPGPPG
RPGLVGPKGDSVVGPRGPPGLPGLPGLPGYGKIGPPGPPGPPGPPAIYGSAATMPGPPGP
PGEPGSPVTRNLVTTFQNIEGMLEKVHLVTEGTLIYLRETSDVFIRVQNGWRKLQLSELI
PVPDESLPPPAVSSYGFQSLPVLNPISNVNNGKPALHLVALNLPFSGDMRADFHCFQQSQ
QAGLMTTYRAFLSSHLQDLVTVVRKTDRYNLPIVNLKGETLFNNWESIFDGNGGQFNIHV
PIYSFDGRNVMTDPFWPQKIIWHGSTTNGIRLVSNYCEAWHTADLAAMGQASPLNTGKLL
DQKTYSCNNRFIVLCIENSFVSDPQGK
Download sequence
Identical sequences ENSGALP00000020568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]