SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000020777 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000020777
Domain Number 1 Region: 976-1129
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-32
Family FAS1 domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2191-2284
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-32
Family Link domain 0.00014
Further Details:      
 
Domain Number 3 Region: 519-656
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-26
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1575-1723
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-25
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 5 Region: 1738-1877
Classification Level Classification E-value
Superfamily FAS1 domain 7.19e-22
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 6 Region: 1137-1263
Classification Level Classification E-value
Superfamily FAS1 domain 1.23e-20
Family FAS1 domain 0.0073
Further Details:      
 
Domain Number 7 Region: 2282-2447
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-19
Family FAS1 domain 0.0086
Further Details:      
 
Domain Number 8 Region: 339-505
Classification Level Classification E-value
Superfamily FAS1 domain 1.07e-17
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 9 Region: 1513-1551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number 10 Region: 1471-1510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family EGF-like domain of nidogen-1 0.064
Further Details:      
 
Domain Number 11 Region: 2079-2115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000457
Family Merozoite surface protein 1 (MSP-1) 0.085
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000020777
Domain Number - Region: 236-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 2124-2158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000395
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 921-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 783-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00127
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 868-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-like domain of nidogen-1 0.039
Further Details:      
 
Domain Number - Region: 199-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00907
Family Merozoite surface protein 1 (MSP-1) 0.063
Further Details:      
 
Domain Number - Region: 1434-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family EGF-like domain of nidogen-1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000020777   Gene: ENSGALG00000012751   Transcript: ENSGALT00000020806
Sequence length 2550
Comment pep:known_by_projection chromosome:Galgal4:1:54927408:55004223:-1 gene:ENSGALG00000012751 transcript:ENSGALT00000020806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENNPLILYFLVFLVAMKVHLTSQVPDQMEKRCDQKLLVQMKTQCTPCSLNLETRCPAGY
IKITNGTGIPDCRYYLEIRSHSLSLPGCRHSCTKEIQQPECCQGYWGPDCMECPGGAASP
CNGRGHCSQGLNGNGTCTCQKGFAGTACEKCAEDHLFGPQCTSVCNCVHGVCNSGITGDG
RCTCLSGYQGLSCDQPIAECKALRCPANSRCTTSGKDGRRLQCTCLPNYHGDGTQCEPIN
PCFTKVCDPNANCTYLGPNRHKCTCREGYRGDGQVCLPIDPCQALYGNCPAQSTICIYDG
PGKSHCECKEHYTNFVPGKGCSMTDICETNNTCHKKAKCSMVAPGQITCTCQRGSVGNGF
VCYGNIMERLQDLNTEAGGRWQGKLTSALALMENVYEWPLSSLGPFTVLVPTNRGLKGIN
IKELLNNNLKAQYFVKLHVIAGQLNTTSLNNTDIIYTLTGKSGEISRGEKDNQLRIRIQG
GRRKGKLLQGNIIASNGILHIVDKAMDNMEPTFESKKEETIMSVLQDNGRYSQFASLIEK
TGLGMDLQQENRPYTVFVPSNDALSNMKAEDLDYLLSAEGSLKLLELVRYHIVSNAELEI
ASLISIGHIRSMAKQFLYFNTTSTGQVLVSGEEMEETDIVAKNGRIFTLAGVLIPPTIVP
ILPHRCDVTKSQIAMGVCESCFSHALSPCPPDSKPIPFSKRTCVIEGPAFPKTGCTRYCK
ITIKEPRCCKGFFGPNCSPCPGGFSKPCSGNGQCIDGLDGNGTCICAAAFQGSLCQFCSD
PDKYGPQCDKKCLCIYGKCDNRIDSDGICLPGSCRNGYTGKFCDKAVVPCEPSLQLCHEH
ADCQLSDGAVSCVCKSGYEGDGMTCSKVDPCASLNSGGCSIHAECIQTGPGRHVCACQAG
WTGDGRDCSAINNCLLPSVAGCHENATCIYVGPGQNDCKCKDGFRGNGIECTPINSCLEQ
NGKCHHLATCQLEPSYGWECVCPKGYEGDGRICYGNAADELSTLPEATTFNQWVNDAQLN
SVLSTTSNLTVLVPSLQAIENMDEDEKDFWMSKGNIPTLLKYHLLTGAYNFADFQNLSSS
DTLPTSLQSNFLHLSKENGNLTVEGAHIVTGDIASTNGIIHVIDKVLIPLRSTIMPRLLA
RLEQMPDYSIFRGYIIQYGLANEIEAANTYTVFAPNNDAIENYLRGKKVATLDEDQIRYH
ILIDEKLLKNDLHNGMHRETMLGYSYHVGFFLHDSQLFVNDAPISYANVATDKGIIHGLG
KVLEIQKNRCDTNHTVITEKCRICSQPSSCPPGTKEIAGEKKYCIFTENSMRLYTIQIGC
QPKCAKTIITRECCAGFFGQQCQPCPGKAGSACFGNGICLDGINGSGICQCGAGFVGTAC
ESCAEGKYGRNCDQVCACVHGKCSSGIDGDGSCECNVGWRGVTCESEIKDDACNNTCHTS
ANCLLLSNDTAYCKCAAGFTGNGTFCTAIDACETSNGGCSANAECRKTTPGNRVCVCKAG
YTGDGVVCLEINPCLENNGGCDKNAECTQTGPNQAACNCLKGYSGDGKRCTYINLCSQNN
GGCSEFAICKDTELTERTCTCKPNYIGDGFKCRGNIHQELLRNSNTSRFYFHLEALSVRD
IAGPGPFTVFIPHTNVLNNDQRVRGWLAKGVMAQILRYHMVGCASLLHRDLTTLTNVTSL
HGDPIQISYVQNSLYLNNKAEIISSDTVGTNGVIHVINQILIPSHIQDFPPGSKRESLEM
VAAKHGYVLFSNLLEKNKLLGLIHDPIHKPVTLFWPTDTAIRRLPQEQQDFLFKKSNTDK
LVQYLKFHIVRNAEILAYQLPRSTLLKTLQGSNLSVSCEDNKEIGTLFLNDRQCKIVQRQ
LEFDGGIAYGIDCLLMDPSLGGRCDSFFAVDIMGYCASCFSGAKCPPGTKPKEGIYRCTY
DSYGLRRDGCRRNCSMVIHTAKCCKGYFGPDCQACPGGPETPCNSHGYCDDGYTGTGECH
CYSGFNGTSCELCLPGRYGSSCKPCECKNNGQCEEGYSGTGRCFCETGWTGRLCENKLAL
TPVCSPSCSANAVCMENNTCQCKPLYNGDGITCTAADLCKQNNGGCHKAANCTQLGVKIF
CNCQKGYKGDGFTCLPINPCADGFNGGCHEHAICTVIGPDKRKCDCKNNYIGDGLNCSVM
QLPLDRCLQDNGQCHPDADCTDLHFQDTTVGVFHLRSPKGQYKMTYEKAKEACANESATV
ATYNQLLYAQKARYHLCAAGWLDGQRVGYPTAFSSPNCGAGYVGIVDYGRRVNLSETWDV
FCYREKEVNCTCKPGYVGDGSSCSGNLLQVLMSFPTLTNFLEKIMAYSNSSRKGRAFLRY
LTDLSVRATLFAPNDSGLRENQTLSGRDIEYHLSNASIMFYEDLTNGTTLLTRLGEKLLI
TDNGGKEYQAPSTEQTETRYVDGSAIVEWDIVASNGIIHVISEPLRAPPVPAHLHAGTGT
GIFFGICLVIGIVAFIGYSYLRFRKKNTGFQHFKSKDDTDVTSLDKPQPSNITNPSYESS
SALTPSEPTYDLFSDSDDQQLVMSGPYDQN
Download sequence
Identical sequences ENSGALP00000020777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]