SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021520 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021520
Domain Number 1 Region: 507-637
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 443-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000117
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 698-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000019
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 733-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.009
Further Details:      
 
Domain Number 5 Region: 407-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 816-926
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 7 Region: 366-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 776-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 661-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000992
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000021520
Domain Number - Region: 483-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0722
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021520   Gene: ENSGALG00000011696   Transcript: ENSGALT00000021553
Sequence length 1300
Comment pep:known_by_projection chromosome:Galgal4:5:52023888:52086423:-1 gene:ENSGALG00000011696 transcript:ENSGALT00000021553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEAVTPAPTCWPSAEPRRIEGERSGGGGALRAAPPAAHALRPPRRPCRQLRALRAALR
RPRGAAAMRPPAPLGSALLLLLLLAARVQVSRGTGYFELQLNSVRNVNGELLNGECCDGE
RNPPDRDCGRDECDTYVKVCLKEYQAKISPGGPCSYGSGSTPVLGGNILYLNGDKYHPRG
RSPETGRIVIPFQYAWPRSFTLILEAWDWDNDTKSGEDLLIERVAHAGMINPEDRWKTLQ
FNGPVANFEVQIRVKCDENYYSALCNKFCGPRDDFVGHYTCDQNGNKACMEGWMGEECKQ
AVCKQGCNLLHGGCSVPGECKCHYGWQGQYCDECVRYPGCAHGSCNEPWQCNCETNWGGL
LCNKDLNYCGNHHPCLNGGTCMNTEPDEYRCACPDGYSGKNCEIAEHACVSNPCANGGTC
HEISSSFKCHCPSGWSGPTCAIDIDECASNPCAQGGTCIDHINSFECICPQQWIGATCQL
DANECEGKPCVNAYSCKNLIGGYYCDCIPGWKGVNCHININDCHGQCQHGGTCKDEVNDY
HCICPRGFTGKNCEIETNECESNPCQNGGRCKDLVNGFTCLCAQGFSGVFCEMDIDFCEP
NPCQNGAKCYDLGGDYYCACPDDYDGKNCSHLKDHCKNNSCKVIDSCTIEVFSNTTQEGI
RFISSNVCGPHGRCISQPGGNFTCACDRGFTGIYCHENINDCLGKPCKNGGTCIDEVDSF
KCFCSSGWEGELCDTNFNDCSPNPCHNGGRCIDLVNDFYCECKNDWKGKTCHSREYQCDA
NTCSNGGTCYDDGDTFRCSCPPEWIGSTCNIAKNSSCIPNPCMNGGTCVGSGDSFSCICK
EGWEGRTCTQNTNDCNPHPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCGY
GATCIDEINGYRCTCPPGRVGPRCQEVIGIGKPCWLKGMTFPHGSRWDQECNSCHCLDGR
IDCTKVWCGKKPCLLHKHWDNSNYQCPMGQECQEKYMKCFQPPCTEWGECSASEPLPANI
KCLPNSGYLDNDCARITLIFNGNKVPQGTTTESICSEIRYLPATRSVSRDRTLIILCDLS
YSTENAVEVAISFVPHRDEQDNSLIQNAANIIVNAITKRQNSTVMLAVTEVKVETIVVGN
SSSDYLVPILCAVFSVVWLTCIIICVWWTRKRRKERERSHPPREEGANNQWAPLNPIRNP
IDRSYSNKDIRYECKNFISPQKRTCDAVEEYVEYEEEEDEEEERDEEMDKFLSHKLTKPL
PTKASDASESSPVKKSLQIGKMDNRSVKNVNASNFEGSRD
Download sequence
Identical sequences F1NMD6
ENSGALP00000021520 XP_001235689.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]