SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021566 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021566
Domain Number 1 Region: 50-191
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-35
Family C-type lectin domain 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021566   Gene: ENSGALG00000013223   Transcript: ENSGALT00000021599
Sequence length 193
Comment pep:known chromosome:Galgal4:11:13502852:13508950:1 gene:ENSGALG00000013223 transcript:ENSGALT00000021599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTGLMIFLLISILLLDQTISQASKFKAKKHSKRRVKDKDDLKTQIDKLWREVNALKEM
QALQSVCLRGTKAHKKCYLISEGTKHFHEANEDCIAKGGTLAIPRNSDEMNTLRDYGKNS
VPGGSEFWLGVNDMVNEGKFVDVNGMALQYFNWDRAQPNGGKRENCVFFSTQGKWVDEIC
RTAKRYICEFLIP
Download sequence
Identical sequences E1BZI3
NP_001264547.1.86415 ENSGALP00000021566 9031.ENSGALP00000021566 ENSGALP00000021566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]