SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021579 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021579
Domain Number 1 Region: 146-250
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-38
Family Link domain 0.0025
Further Details:      
 
Domain Number 2 Region: 254-338
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-25
Family Link domain 0.0036
Further Details:      
 
Domain Number 3 Region: 43-146
Classification Level Classification E-value
Superfamily Immunoglobulin 4.41e-17
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021579   Gene: ENSGALG00000013234   Transcript: ENSGALT00000021612
Sequence length 340
Comment pep:known_by_projection chromosome:Galgal4:25:508028:510241:-1 gene:ENSGALG00000013234 transcript:ENSGALT00000021612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRVLFASLWLLAASPTSSIFQKPTGSPATPRLQYLLEPLHTAVHTQRGATATLPCVLRA
LPRNYRVKWSKVEPANYGESVIIITNGLYHKNYGPLSPRVRLRHSHRYDASLTITNVALE
DEGRYRCQLVNGLEDESVSLTLHLEGVVFPYQPSNGRYRFNYHEAKRACEQQDARLATYQ
QLYKAWMEGLDWCNAGWVLDGTVHYPIINSREPCGGRLLLPGIRSYGAKDKQRDRFDAFC
FTSALQGEVYFIRGHLSFKEAGQACRNHGATIAKVGQLYSAWKFLGLDRCDGGWLADGSV
RYPITTPRQRCGGLPEPGVRSFGFPRKELRTYGTYCFVGT
Download sequence
Identical sequences H9KZY4
XP_015153906.1.86415 ENSGALP00000021579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]