SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021582 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021582
Domain Number 1 Region: 719-871
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-44
Family C-type lectin domain 0.00000656
Further Details:      
 
Domain Number 2 Region: 156-270
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-42
Family Link domain 0.0023
Further Details:      
 
Domain Number 3 Region: 271-362
Classification Level Classification E-value
Superfamily C-type lectin-like 1.11e-28
Family Link domain 0.0039
Further Details:      
 
Domain Number 4 Region: 872-931
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 46-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000121
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021582   Gene: ENSGALG00000013237   Transcript: ENSGALT00000021615
Sequence length 940
Comment pep:known_by_projection chromosome:Galgal4:25:494218:508583:1 gene:ENSGALG00000013237 transcript:ENSGALT00000021615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLPLLLLWAFAPTVVPEVLSPEDVTDDLKALQVSIPRHPALHAVLAGDVTIPCLITY
LAPLPTASTAGRRAVLGAPRVKWTFISEGREAEILVARGERVKVSEDYRLRASLPVFQQR
YTDASLLLTELRPNDSGIYRCDVQHGIEDGHDILDLRVKGVVFHYRGGSTRYTYTFAEAQ
EACTAISASIATPEQLYAAYLGGYEQCDAGWIADQTVRYPIHTPREACYGDMNGFPGVRN
YGVVDPEDMYDVYCYAEDVPGEIFLETAPDKFTLEEAAARCRAQGAVLASTGQLYAAWSA
GLDACNPGWLADGSVRYPIVTPRERCGGALPGVKTIFQFRNQTGFPDAQSRYDAYCYREG
TNSFPEAAGKYQAREPEGLQEIVTVAEKLEELQLPKAQVEIESRGAIYAVPFFKDVADAE
LEKPSLSPEDTRHPPVDASSSSARGHHPSSAAPFPTAPAVPKAGVPHSCAAQPGSPSPAD
QDGATGKGGRCAEARQEPSRTEDGAALEWPLGSVLGEDFGNTAAESPGRGQEPGQPMKPN
VQTLLVGTEGPSDALSPAVAAADIQEPSPSIGSRGAGGASTPIHTAGAAEDPELSGDVTE
NPGASPLPPAPPQLQDDGEEQSGAPWLSSPTAPGDGGTAPATAVTPWHAEVPGSSDALQT
PSTDRGMPAASSEEEEDEEEEEDEEERPMPSVATVEGFLAAIPGEPGGCIPNPCLNGGTC
IEDGTHPTCLCLPGYGGSSCERPLKRCSPSWDSFQGACYKHFSTRRSWEDAESQCRNFGG
HLATILTPEEQDFINEQYREYQWIGLNDRTIEGDFQWSDGSPLLYENWHPGQPDSYFLSG
ENCVVIVWHDGGQWSDVPCNYHLSYTCKMGLVQCGPPPTVSNARAFGKPKQRYEIGSITR
YHCRHGFAPRRSPIIRCREDGIWERPQLSCRPGLARHPED
Download sequence
Identical sequences ENSGALP00000021582 XP_015153902.1.86415 XP_015153904.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]