SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021785 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021785
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-75
Family Eukaryotic proteases 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021785   Gene: ENSGALG00000013378   Transcript: ENSGALT00000021823
Sequence length 252
Comment pep:novel chromosome:Galgal4:28:1210143:1212697:-1 gene:ENSGALG00000013378 transcript:ENSGALT00000021823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQRGEEMRRPHCPLLLALLLLLSCLRADGSALRGQIIGGHEAKPHSHPYMAYLKLRMSAC
GGFLVAPDWVMTAAHCLGGNITVILGAHDIYEPEQSQQVRGVLKYYPHPAYDPNTMANDI
MLLKLTAKVKLNKYVRTIALPKTSSDLPTGTSCTIAGWGLIDEDERTSKLFETEVSIYSR
RKCILFYPHLDNGMVCAGSFHEMKDSSQGDSGGPLVCNKVAQGVVSFGYDSPPGVYARIA
NYLPWIKKVMKK
Download sequence
Identical sequences ENSGALP00000021785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]