SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021815 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021815
Domain Number 1 Region: 1136-1362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-40
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 173-285
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-30
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 491-598
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 600-712
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 5 Region: 1385-1583
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.1e-26
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 280-394
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 65-171
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-26
Family Cadherin 0.00077
Further Details:      
 
Domain Number 8 Region: 700-815
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 394-495
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 10 Region: 6-71
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000458
Family Cadherin 0.015
Further Details:      
 
Domain Number 11 Region: 2181-2438
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000119
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 12 Region: 1063-1153,1350-1401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 808-910
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000528
Family Cadherin 0.0094
Further Details:      
 
Domain Number 14 Region: 1716-1755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1587-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000432
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 1622-1668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000944
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000021815
Domain Number - Region: 1766-1818
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00188
Family Hormone receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021815   Gene: ENSGALG00000013399   Transcript: ENSGALT00000021853
Sequence length 2765
Comment pep:known_by_projection chromosome:Galgal4:1:15539606:15697582:-1 gene:ENSGALG00000013399 transcript:ENSGALT00000021853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALFDERSNDYFSIDPQTGGVVTARSLDRETKDTHVLKVTASDHGSPRRRSATTYLTVT
VSDTNDHEPVFEQPEYRESIRENLEVGYEVLTIRATDGDAPANANMLYRLLEPGAGDGVF
EIDPRSGVVRTRAPVDREEVSEYHLVVEANDQGKDPGPRSATAMVHITVEDENDNYPQFS
EKRYLVQVQEDAPVNSQILQVQATDRDRGSNAQVHYSIVSGNLKGQFYIHSFSGAIDLIN
ALDYETIREYTLRIKAQDGGRPPLINSSGMVSVQVVDVNDNAPIFVSTPFQATVLENVPL
GYSVLHIQAVDADSGENARLEYKLIEMAPPAGVAPASGDSGFPFQINNSTGWITVAAELD
RETVENYHFGVEARDHGVPVMTSSASVSITVLDVNDNNPTFTEKVYHLRLNEDAAVGSSV
LTLTAVDRDVNSVVTYQITSGNTRNRFAITSQSGGGLITLALPLDYKQERQYVLTVTASD
GTRFDTVQVFINVTDANTHRPVFQSSHYTVSVSEDKPIGTSIVTISATDEDTGENARITY
ILDDNIPQFRIDPDTGTITTLMELDYEDQASYTLAITAHDNGIPQKSDTTYVEILILDAN
DNAPRFLRDRYQGSVFEDVPLSTSVLQLSATDRDSGLNGRLLYTFQGGDDGDGDFYIEPT
SGVIRTLRKLDRENVAVYSLRAFAVDRGSPPLKASVDIQVTVLDINDNPPVFEKDEFDIF
VEENSPVGSIVARISAADPDEGTNAQIMYQIVEGNIPEVFQLDLLNGDLTALMDLDYESR
TEYVIVVQATSAPLVSRATVHIRLLDQNDNPPVLQDFQILFNNYVTNKSNSFPSGVIGKI
PAHDPDVSDSLAYTFVQGNELNLLLLDSATGELKLSRDLDNNRPLEALMKVSVSDGVHSV
TAVCTLRVTIITDDMLTNSITVRLENMSQERFLSPLLSLFVEGVATVLSTTKDGIFVFNI
QNDTDVSSNILNVTFSALLPGGIRNKFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNIC
LREPCENYMKCVSVLKFDSSAPFISSNTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLC
YSNPCGSNGLCRSREGGYTCECYEDYTGEYCEVNARSGRCAPGVCKNGGTCINLLIGGFK
CECPPGEYERPYCEMTTRSFPPQSFITFKGLRQRFHFTVSLMFATRERNALLLYNGRFNE
KHDFIALEIIEEQIQLTFSAGETTTTVAPFVPGGVSDGQWHSVQVQYYNKPNIGRLGIPH
GPSGEKVAVVTVDDCDTAVAVRFGSLIGNYTCAAQGTQTGSKKSLDLTGPLLLGGVPNLP
EDFPVHNRQFIGCMRNLSIDSKPIDMASFIANNGTLPGCAAQRNYCEANWCQNGGTCVNK
WSTYICECPVQYGGKNCEQVMPSPQRFSGESIIIWSELDITISVPWYIGLMFRTRKVNGM
LMQANAGTASKINIQILNNYVQFEVYSGMTQVASLKMTQSRVSDGEWHHLLIELKSAKDG
KDIKYLAVMSLDYGMYQSTVQIGNQLPGLKMKSIIVGGVSGDQVSVQQGFYGCMQGVRMG
ETSTNIATLNMKQAIKINVKEGCEVDNPCDSNPCPQHSYCSDDWDSYSCVCDPGYFGRDC
VDVCNLNPCEHVSTCVHKPSSSHGYTCECGQSYYGQYCESKIDLPCPRGWWGNPICGPCN
CETSKGFDPDCNKTNGECHCKANYYRPQSSDTCYPCDCFPSGSHTRSCDMETGQCPCKPG
VIGRQCNRCDNPFAEVTARGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAV
RHCNIEKGWLPPELFNCTTNTFVDLKVMNEKLHRNETILDGDKTIQIVRVLQNATKYTHS
MYGNDVRTAYQMMIRVLRYESQQQGFDLAATRDVEFNENIIKVGSALLDPNNKEQWEQIQ
RTEGGTAHLLRHYEDYFNNVAQNMKKTYMRPFVIVAANMIIAVDIFDKSNFTGARIPRFH
EIKEDYPKDLESSVIFPDTLFRPSDRKVPTMRPSNQKLSSKVNSDARSPESMFTKRRKRH
PDDSTHHTVAMVIIYRSLGHLLPENYDPDRRSLRLPNRPIINTPVVSTAVHSDGELPPNL
VEKPIIVEYTMLETEERTKPVCVFWNHSIMIGGTGAWSSRGCELFSRNQSHIACQCNHLT
SFAVLMDISKRENGEVLPLKIVTYTTVSISLVALLITFILLVLIRTLRSNLHSIHKNLVA
ALFFSELVFLIGINQTENPFVCTVIAILLHYFYMSTFAWMFVEQLHIYRMLTEVRNINFG
HMRFYYVVGWGIPAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIVIVVVINTVI
FILAMKASCRRRQRSFEKTGVISVLRTAFLLLLLISATWLLGLMAVNSDVMTFHYLFAIF
SCLQGLFIFFFHCVFNKEVRKHLKNTLTGKKPLPDDSTATRATLLTRSLNCNNTYIEEPN
MYRTTIGESTVSLESTVRSAKSHNSYLAYILRDDAAHKLSGSSSQARAGQTEADSSIFHR
NPSKSNEHDSDSDSELSLDEHSSSYASSHSSDSEEDGLEPEKKWNTSTAKNNERGPLHST
PKVDTLPNHVKPYWPTECITASDSEDPSGKQKLKVETKVNVELHRENQVNHSNEAPQDKE
NDGQQKENRPLSHQNNQQPEQRKGILKNKVTYPPPLIDKNMKNRLREKLSDYNQTTISSR
TTSLGTNDGVRSPSDSGVTVKNARREQSRDQLNGMAMNVHVGTGHAETSDSEGSNETSIR
TTRKL
Download sequence
Identical sequences ENSGALP00000021815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]