SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022241 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022241
Domain Number 1 Region: 8-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-87
Family Eukaryotic proteases 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022241   Gene: ENSGALG00000013701   Transcript: ENSGALT00000022280
Sequence length 267
Comment pep:known chromosome:Galgal4:21:4925271:4927174:-1 gene:ENSGALG00000013701 transcript:ENSGALT00000022280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAVCLAILLGYAYGCGQPAVPPLLGARVVGGEDARAHSWPWQISLQYSRDGAWRHTCG
GTLISPSWVLTAAHCISSSLTYRVVLGEHNLAVEDDGAVVAEVEKIVVHEKWNSFLIVND
IALIKLTEPVQESDTIQAACLPPSGLELENDYPCEITGWGRLWTNGPLAEVLQQALLPVV
DYATCSQSDWWGGLVRTSMVCAGGDGVVSGCNGDSGGPLSCQRNGLWEVHGIVSFGSSWG
CNTAKKPTVFTRVSAYIDWINEKISEN
Download sequence
Identical sequences A0A1D5NU45
NP_001264846.1.86415 ENSGALP00000022241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]