SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022274 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022274
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 170-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-18
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022274   Gene: ENSGALG00000013729   Transcript: ENSGALT00000022313
Sequence length 533
Comment pep:novel chromosome:Galgal4:2:92484359:92551804:1 gene:ENSGALG00000013729 transcript:ENSGALT00000022313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHGRSFLHIVASLIILHLSGATKKGTEKQTTAEGQKPVQCGTWTKYAEGGIFTSPNYPN
KYPPDRECVYIIEAAPRQCIELHFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPMIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPE
GIVESVQIVKEGKASETEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRSSRFQMLFTSFQEPPCEANTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKANLLDQLTNTSGTIIGVTSCIVIILIVIS
VIVQIKQPRKKFVQRKTDFDQTVFQEVFEPPHYELCTLRGTGTTADLADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASVLTEIQPQPVKPLIQPVNRRNILVMKH
SYSQDAADTCEIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences ENSGALP00000022274 XP_015137918.1.86415 XP_419104.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]