SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022368 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022368
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 152-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000133
Family Pentraxin (pentaxin) 0.012
Further Details:      
 
Domain Number 3 Region: 853-1139
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000101
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022368   Gene: ENSGALG00000013803   Transcript: ENSGALT00000022408
Sequence length 1167
Comment pep:known chromosome:Galgal4:3:52148764:52255579:-1 gene:ENSGALG00000013803 transcript:ENSGALT00000022408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHINEMWCCHWKWKLQHCLYLFILYIICMQQAAHGCYNCRTVLTDPSGVFTSPCYPSDY
PNSQACKWIIRAPHGFIIQLTFSDFDIEEAPGCIYDSLTLDNGESPMNLCGITAKGLSYN
STGNEMIVSFKSDFSIQKKGFNASYVRIAVSLRNQKVIIPQDPDADAVSVAETVLVPELS
QFTLCFEATKSSSDDNDDWKIFSYTDASSKEFFGFGKTAKGHFLSISDTQCILDNALPQN
AEFFTGTFEQLCVVGDSFSGTIGVYAKSIYHNTYCPDMFGKVIPGNGRLVLGSNSNEVSS
LNGDIYNFRLWNFTMNAQTLANLSCDVKGNIVDWENEFWSIPTSALKAENNLSCGSYLIP
SSAIEPTSCANLGSLCQATVNATTPTPPTVTTNMPDTNRTDKPNNGGLFYRISITVFSYN
SNSESKVHDVVAEWLNHTFQNWNYTVYVVNISIQPGTIKEAVREKRNIDSKRFEVLALLV
YNATNNINLEEQDIRQKLINNNESIAEGYRLHTVEVDPVEKCLAEENPPNYFWPDTRPTV
TNFTFCHGSSVQIASRTCYLGLQNYTSYWGQPDLRNCTENAADIANQLLNLTGEGQQLTS
DKVNDVVQKLKKIVNDEEIDESLGSTVVTIFSNILNSSDSVLAASSSEALKTIDALALKI
QFTGPSMSISTRNLALGVSSVNSTSFKGSSFSVSPQNNASDFQIDFDKDQTNAIASVILP
PSLLKNLSQDDFEVISRAQFTFFNKNGLFQDAETPGNLTSFVVACSIGNITIRDLQEYVK
ITIKHTKIQEDPKPTCVFWDMAKNGGNGGWNPTGCKVQADSNENETVCLCNHLTHFGVLM
DLQGTATEIDAQNTKILTFITYIGCGISAIFSAATLLTYIAFEKLRRDYPSKILMNLSTA
LLFLNLTFLLDGWIASFDIDGLCIAIAALLHYFLLATFTWMGLEAVHMYIALVKVFNTYI
RRYILKFCIIGWGLPALVIAIVLASTNKNASRVYGKELYGRDATGQGGDDFCWIKNKVVF
YVTCAGYFGIMFLLNVAMFVVVMVQICGRNGKRTNRTLKEEILRNLRSVVSLTFLLGMTW
GFAFFAWGPLTLPFLYLFSIFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFRLADNSD
WSKTATNIIKKSSDNLGKSLSSSSIGS
Download sequence
Identical sequences ENSGALP00000022368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]