SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022972 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022972
Domain Number 1 Region: 342-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 184-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000769
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 480-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family EGF-type module 0.008
Further Details:      
 
Domain Number 4 Region: 307-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000481
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 5 Region: 525-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000329
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022972   Gene: ENSGALG00000014233   Transcript: ENSGALT00000023014
Sequence length 704
Comment pep:known chromosome:Galgal4:1:70623970:70705990:1 gene:ENSGALG00000014233 transcript:ENSGALT00000023014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLRGARPLRLLLLLLALLPALRGQDLSMEECCDKGVEWANKNRICTSLPLISESRECS
MTQVQCCRSKLEEHYCSDGIEFASVHEECDSHNGENSTCEAEYFKKCCYCCLLGKTAQVQ
GQSCEPNLKIGYQCGIVFRACCVKGQEGTDVSISDDAPKKEQVEISKEELDQEDPYLHDG
CRGGGPCSQQCRDTGSSYVCSCFVGYQLQPDGVNCEDINECITGTHSCGIGQTCVNTLGS
FRCQRDTSCGTGYELTDDSRCKDIDECETGTHNCPPDFICQNTPGSFRCRPKLQCMNGFI
QDALGNCIDINECLSTNMPCPAGQICINTDGSYTCQRISPSCGRGYHLNEDGTRCVDVDE
CSSSDQPCGEGHVCINGPGNYRCECKSGYSFDVISRTCIDINECRRYPGRLCAHKCENTP
GSYYCTCTMGFKLSSDGRSCEDLNECESSPCSQECANVYGSYQCYCRRGFQLSDIDGISC
EDIDECALPTGGHICSFRCINIPGSFQCTCPSTGYRLAPNARNCQDIDECVTETHNCSFN
ETCFNIQGGFRCLSLECPENYRKSGDTVRLEKTDTIRCIKSCRPNDVNCVLDPVHTISHT
VISLPTFREFTRPEEIIFLRAITPTYPANQADIIFDITEGNLRESFDIIKRYMDGMTVGV
VRQVRPIVGPFHAILKLEMNYVMGGVVSHRNIVNVHIFVSEYWF
Download sequence
Identical sequences F1NX60
ENSGALP00000022972 ENSGALP00000022972 9031.ENSGALP00000022972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]